SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_1233
Domain Number 1 Region: 23-213
Classification Level Classification E-value
Superfamily GAF domain-like 1.02e-26
Family GAF domain 0.00022
Further Details:      
 
Domain Number 2 Region: 209-288,429-496
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000109
Family HD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1233
Sequence length 544
Comment (Trichodesmium erythraeum IMS101)
Sequence
MIQLNTLKLFQELTETSELLIIEQLLDIGVALSDTYNLGELLNLILSKSREITCSDAGSV
YLVDEVNFKERKLVFKVAQNDSIPELAFQEIALPIDFKSLTGYVALTGHTLNIPDAYNLP
KDIPYKFDESFDEKTGYRTCSVLILPVQKQNQEIIGVLQLINRKVQPDVVITKENAKELT
KAYSKWEQRILISLASQAAISIERNNLQENIENLFEGFVKASVQAIEARDSCTSGHSERV
AKLTVGLCQEVNIITNGVFSGTYFSNEQIQEMRYAALLHDFGKIGVPEGILTKRKKLYQE
QLELIKQRFSVAQRTLEMESAQTKYEYLLRHLSGTYQSHTQESCPLCQKIENLDLELKTA
ITQLNNYWQTILIANEPKVLAEEPLKQLQQISLYTYKDTDGQIKPLITSEEMAQLTVPRG
NLTPEERRAVEAHVTHSYEFLKQIAWTKNLQNIPEIAYGHHEKLDGSGYPRGLKKNEISL
QTQIIVIADIYDALTAGDRPYKQGLPVEAALRIMRSEAAENKINSHFLELFEQKQVFSIL
GHSK
Download sequence
Identical sequences Q116J1
WP_011610963.1.43450 203124.Tery_1233 gi|113474995|ref|YP_721056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]