SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1772 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_1772
Domain Number 1 Region: 213-538
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.15e-72
Family Integrin alpha N-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 1109-1224
Classification Level Classification E-value
Superfamily CalX-like 1.06e-28
Family CalX-beta domain 0.00073
Further Details:      
 
Domain Number 3 Region: 546-656
Classification Level Classification E-value
Superfamily CalX-like 2.75e-28
Family CalX-beta domain 0.00092
Further Details:      
 
Domain Number 4 Region: 653-768
Classification Level Classification E-value
Superfamily CalX-like 3.53e-28
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 5 Region: 886-996
Classification Level Classification E-value
Superfamily CalX-like 1.16e-27
Family CalX-beta domain 0.00077
Further Details:      
 
Domain Number 6 Region: 997-1107
Classification Level Classification E-value
Superfamily CalX-like 3.92e-27
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 7 Region: 769-884
Classification Level Classification E-value
Superfamily CalX-like 1.31e-26
Family CalX-beta domain 0.00083
Further Details:      
 
Domain Number 8 Region: 1255-1336
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000392
Family Collagen-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1772
Sequence length 1340
Comment (Trichodesmium erythraeum IMS101)
Sequence
MDEFSPDDHSLFPEEPDETSLNVHYLPGADSNPEVTDPMIQGAWGEVRDELADFILAPEF
DDYIKTAFGETVDPELAKEQIKDVLTGENLPEVIMLPAADMEPAVGAYDPLTGSIYLADS
LLPDTDGVLVDVLLEELGHFLDSQLSESDSPGDEGELLAALVRGEELTQFQVMMLRGQDD
RVDIWVGGVEVEVEASEKVDFEKARNFKVGDGPYSVAAGDFNGDGIPDLAVANFSSDNVS
VLLGKGDGSFGSATNFPVGDGPASVAAEDLNGDGIPDLAVANDGSDNVSVLSGKGDGSFG
SATNFPVGDRPVSVAAGDFNGDGIPDLAVANYRDDNVSVLLGKGDGSFGSATNFPVGGRP
LSVAVGDFNGDGIPDLAVANWVDDNVLVLLGKGDGSFGSATNFPVGDGPISVAVGDFNGD
GIPDLAVANRWNDNVSVLSGKGDGSFGSATNFPVGDDPFSVAVGDFNGDGIPDLAVANGG
DDNVSVLSGKGDGSFARRTNFPVGDGPASVAAEDLNGDGIPDLAVANYWDDNVSILINKT
PITIIPNITISDTKLTEGNTNKTAKFNVTLDNPTTTTVKVNYTTANQTAQVNQDYKLTKG
TLTFRPGETNKNITVPILGDNRDEPEEKFRVDLSRPQNANIKDGRATGTIVDNDPVPQIS
IGDAKITEGNRGHKNMEFEVKLNNPSGKTVKVNYGTQEGSAKSGKDFQNKRGVLTFQPGQ
TKKIVSIPIFGDRVDENNEQFQVKLSGAENGNFSDNTAVGKIIDNDQVSQISISDAKTVE
GNRGQKNMEFEVRLNNPSSQTVKVNYTTVDGNAKSGKDYQKKSGVVTFKPGETKKSINIS
ILGDTFYENTELFEVKLTRAQNAELPADPRKQYGAAIILDNDELPKISIGDAKMTEANRG
KKNMEFAVRLNNPSDQTVKVNYASVDGTAKSGKDFQSQKGVVTFKPGETKKTVNIPILGD
TLVENTEQFQVKLSRAKNAELSDSQAVGRIQDNDQPPQISISDAKVTEANRGEKNMKFEV
TLDNSSAQTVKVNYETINGSAKAGEDFQKKKGVLTFKPGERKKTVNVPILGDLVDENNEN
FQVKLSDAKNGKLSDEKAVGRIIDNDISPQISIGDARVTEANRGEKNMKFEVKLDNSSSQ
TVKVNYETINGSAKAGEDFQKKKGVLTFKPGETKKTLNVPILGDTVYEKNEKFQVKLSGA
KNAKLSDADAKAVGIIRDNEKPVPEVFKDAVDMGVLELKQTSSRDNIGFPVGPVDRNTED
YFRFEVEKEGLVTIFVDSFIQNLGIELYGEDESFLNQSNEEDIAIEKIQTTLEKGVYYLK
VFSIGSGRTDYNVSINIVES
Download sequence
Identical sequences Q114P2
203124.Tery_1772 gi|113475444|ref|YP_721505.1| WP_011611407.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]