SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_1890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_1890
Domain Number 1 Region: 48-272
Classification Level Classification E-value
Superfamily vWA-like 1.43e-53
Family Integrin A (or I) domain 0.00008
Further Details:      
 
Domain Number 2 Region: 573-662
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000327
Family Collagen-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_1890
Sequence length 663
Comment (Trichodesmium erythraeum IMS101)
Sequence
MAKKTKSSITNIVDRKGGLNPDVVDVTLVPGDNVTFDITAKVTKKSSTKLPLDLVFLSDL
SGSYGDDLPVLQDLVPKLVSSVRDIQPNSQFGLASYIDKPKDPFGGPKDFVYRMESAITK
SRTDFQKAMDDLKIGNGNDGPEAQLEALMQLALREKEIGFRKKSRRVVVLSTDANYHKAG
DGKKAGIKTPNNGDTVLDGKPAGTGEDYPSIDQVRDALQEAGIVPIFAVTGNQVRNYKKL
VDKLGFGTVERLSRDSSNLVKVVTEGLEEVFSDLTIVPQSDEFGYIKSIKPTTYENVRPG
QSRTFEVKLGITDLDASQKDRLSLEVLGYGETKVNVTPIVNTKPIASNDNLATNAGSKLV
IKPKELLANDTDKDGDKLSISKVGKASNGKVILGKNGKVTFTPDKDFTGKASFEYTIDDG
NKGRDSATVTVQVRDNSDPIAKDDKVFFVRPKLFHAIQAKKLLKNDQDKDGDKLTIIKVS
NATKGEVELTKSGEITFTPSGKHKKFSKGSFEYTISDGKGGTDTAKVMLKRVGDLPSSKR
SAGSEKRDSLTGNIDDKAPGIPLGTVVDPLTQSSDIGFKNGGKVDQNDYYNFVVPEPSFV
SIKLDGLRSNANLELYDSDKVSLDSSTNSGNAPEEINTFLFPDTYVVGVFDQGSGTPYNL
SIL
Download sequence
Identical sequences Q114C8
WP_011611519.1.43450 203124.Tery_1890 gi|113475558|ref|YP_721619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]