SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_2606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_2606
Domain Number 1 Region: 9-224
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.11e-80
Family D-ribulose-5-phosphate 3-epimerase 0.0000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_2606
Sequence length 236
Comment (Trichodesmium erythraeum IMS101)
Sequence
MTTTEKKPIVISPSILSADFSRLGDEVRAVDQAGADWIHIDVMDGRFVPNITIGPLIVKA
LRPVTKKPLDVHLMIVEPEKYVEDFAKAGADIISVHAEHNASPHLHRTLGQIKELGKQAG
VVLNPSTPLELIEYVLDLCDLVLIMSVNPGFGGQSFIPTVISKIRKLREMCDARGLNPWI
EVDGGLKTDNTWQVLEAGANAIVAGSAVFKANDYAEAINGIRNSKRPVPQPQLATV
Download sequence
Identical sequences Q111M3
gi|113476213|ref|YP_722274.1| 203124.Tery_2606 WP_011612163.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]