SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_3006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_3006
Domain Number 1 Region: 110-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.07e-36
Family Ribosomal protein S3 C-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.14e-35
Family Prokaryotic type KH domain (KH-domain type II) 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_3006
Sequence length 242
Comment (Trichodesmium erythraeum IMS101)
Sequence
MGQKIHPTGFRLGITQEHRSRWYADPKNYPDTLQEDHKIRQYVKATLANAGISQIRVERK
AEQIDLEVRTARPGVVVGRGGAGIDSLRVGLQKLLGSNRQIRINVVEVTKVDTDAMLIGE
YIAQQLEKRVSFRRVVRQAITRAQKAGVEGIKIQVSGRVNGAEIARTEVTREGSVPLHTL
RANIDYAYCTAKTIYGILGIKIWVFKGEIIPGQEEIANAKVNQPKRRQQKRRQQYDDRSN
EG
Download sequence
Identical sequences Q110B3
WP_011612516.1.43450 203124.Tery_3006 gi|113476573|ref|YP_722634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]