SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_3497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_3497
Domain Number 1 Region: 371-788
Classification Level Classification E-value
Superfamily TPR-like 3.45e-34
Family Tetratricopeptide repeat (TPR) 0.00076
Further Details:      
 
Domain Number 2 Region: 165-486
Classification Level Classification E-value
Superfamily TPR-like 2.46e-32
Family Tetratricopeptide repeat (TPR) 0.0007
Further Details:      
 
Weak hits

Sequence:  203124.Tery_3497
Domain Number - Region: 66-150
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00798
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_3497
Sequence length 1328
Comment (Trichodesmium erythraeum IMS101)
Sequence
MFTRIFSITYLAQTCLAAIVIINGLEALVVQPVWAQTYVFPQEPSTTEATEELIINGTLN
ENSELLEDGSYFQWHTFTGKAGEAITIELSSSEFDAYLMLVDPRSNKIAENNDGGENNNA
KITITLPTTGTYTVIVNTYEKGQQGSYKLSWRQASAKDQSLASATELNDKAIELYKQGKY
DEAVPLLEQSLKIRQQALGAEHPDVAASLNNLAFLYNAQGRYTEAEPLYIQALEMRKKLL
GAEHPDVASSLNNLAFLYKAQGRYTEAEPLYIQALEMRKKLLGAEHPDVATSLNNLASLY
ESQGRYTEAEPLYIQALEIFKKLLGAEHPDVATSLNNLAFLYNAQGRYTEAEPLYIQALD
MTKKLLGAEHPSVATSLNNLALLYEDQGRYTEAEPLYIQALEMRKKLLGAEHPDVATSLN
NLAGLYNAQGRYTEAEPLYIQALEMRKKLLGAEHPDVATSLNNLASLYESQGRYTEAEPL
YIQALEIFKKLLGAEHPDVASSLNNLAGLYKDQGRYTEAEPLYIQALEMRKKLLGAEHPD
VASSLNNLAALYKDQGRYTEAEPLYIQALEMRKKLLGAEHPDVASSLNNLAGLYNAQGRY
TEAEPLYIQALEMRKKLLGAEHPLVASSLNNLAGLYNAQGRYTEAEPLYIQALEIFKKLL
GAEHPLVATSLNNLAGLYNAQGRYTEAEPLYIQALEMRKKLLGAEHPYVATSLNNLALLY
YAQGRYTEAEPLYIQALEMRKKLLGAEHPDVASSLNNLATLYNVQGDIASAVQYLKRGLE
VQEKNLTYNLAAGAEPQKNKYLQTISGAKARAISLHLQTAPNDPAATTLALTTILRRKGR
LLEFFTTSRQILRQQLDTQGLQWLDELNNIYSELSTLLYNGPKDLPLETYKENFALLEQQ
AKELEDKISRRSSQFRAATQPVTLEAIQELIPANAALVEFVQYSPFDPKTGKFGKPRYGV
YVLSREGEPQGMDLGTVEEFKNIIKVFRTSLRDKSQTPLKQLKDTARELDQKLMQPVRQL
LGSQKQILISPDSNLNLIPFEALVDENNRFLVENYSFTYLSSGRDLLTFTSTPRNTSPAV
LLGYPTYSEKDQVTIKSKGRFGVSDLGLSGLPGTEEEVKAIGELLGVEPLLREAATEEAV
KQVQSPFILHIATHGLFETIEDPEKYPTINKNSLLRASLALAGVKEEQIDGDNGLLTALE
AAGLNLLGTELVVLSACDTGLGGISPGEGVYGLRRAFAIAGSQSQVISLWKVDDQGTKDL
MVKYYQRLLGGDMGRTEALRQTQLEMLGGEAGEKYSHPYFWASFIPSGNWLAIPPRVESK
KSKVNSQR
Download sequence
Identical sequences Q10YT7
gi|113476999|ref|YP_723060.1| 203124.Tery_3497 WP_011612929.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]