SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_4096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_4096
Domain Number 1 Region: 10-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_4096
Sequence length 405
Comment (Trichodesmium erythraeum IMS101)
Sequence
METGEIPQGEKPSNKITKICILGSGFGGLYTALYLNSFWGFKHKNCEVILIDQHDHLVFT
PLLYEVITDELQTWEIAPSFAKLLQNKKILFCQDTIQNIDFKARKVKLLEQGSLAYDYLV
ITVGVTNGKLPTTAENVLTFRTLADAQILEKKLQTLENSNQELIRVSIVGGGPSGVELAG
KIADRLGRRGEIRLIERGKEILKNFTPATRKNAQRALDKRNVLISLETTVDTIEVDKITL
WQSNESVIILTDLVLWTAGTQVREWVKNLNCYHNSRGQLICEQTLQLVGYSEVFALGDIA
EILYPNGKKLPATAQVAYQQASQAAKNLWAILNNKRPKPFRYLHLGEMITLGVNSAAVSS
FGISLHGWLAALVRLSVYLQRLPTFSHGFQVLCNRLKIWLAKRKR
Download sequence
Identical sequences Q10XC0
gi|113477516|ref|YP_723577.1| 203124.Tery_4096 WP_011613434.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]