SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203124.Tery_4352 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203124.Tery_4352
Domain Number 1 Region: 116-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.3e-61
Family NadC C-terminal domain-like 0.00000962
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.46e-28
Family NadC N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203124.Tery_4352
Sequence length 290
Comment (Trichodesmium erythraeum IMS101)
Sequence
MKGVIPPKIILDNLLKDWLLEDIGRGDRTTSGLLLEDEVIVGTGHWLIKEPGVIAGLPIA
ARVFELLDQQVNFLPTVAEGEWCEKGTVVAKLDGSLDSLLTGERVALNLGMRLSGIATMT
RKYVEKIAGLPVQLVDTRKTTPGLRILEKYATQVGGAKNHRMGLDDGVMIKDNHIAAAGG
IGEAIAKVRERIPYPLTIEVETETLVEVERALEHQADIIMLDNMSVEVMEQAVKMIRQNN
SRIKIEASGNITLETIRNVAETGVDYISTSAPITRSTWLDLSMKITKAVS
Download sequence
Identical sequences Q10WN0
WP_011613670.1.43450 203124.Tery_4352 gi|113477756|ref|YP_723817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]