SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 205921.SAK_1293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  205921.SAK_1293
Domain Number 1 Region: 582-671
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000562
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 205921.SAK_1293
Sequence length 854
Comment (Streptococcus agalactiae A909)
Sequence
MRPIVRKKMYKKGKFWVVAGIVTILGGSAILGQDVKAEQAEAVTSTISEKTDSSQTISDT
SKLTLPVNSSEAMKNSAEPLIKTAFATSVSSNPREIAATPVKTFDASSKVVVKASTAEHS
ANQTNSNVNQVANDSEVITQQNSTKQLPTVTYSAHVQDIGWQKSVDNATVSGTVGQEKQI
EAIKLSIKAPEGITGKLSYKTYVKGQGWQPSVESGQVSGTVGQSRPIEALSINLTDNLQK
LYDVYYRVHVQDIGWMAWAKNGAYAGTLGMSKRLEAYEVKFTLKGQSVLTPIIPKEERPV
LNYQVKVGQNGWQSNKLEGQMAGTLGESKALDGVKFTLSTLKYGDILYRTHVQDKGWGEI
LGSQTSKDYQGKRLEAIQLDLSGNLKQNYDIYYRAHVQDKGWMAWQKNNSVAGTVGESKR
LEALEVKLVAKASDFSSQTNHSFLEMKHPGLSYQTYLQKDGWQPTVLEGQLGGSIGLSKS
IKAIKLNLGSTALGNIEYRTFLNGSGWQTVVNAGRESNVPNESQQVEAIQMRLTGLLSKT
YSVMYRVHMQDYGWQDWTYNNNIAGSTNQGKRIEAIEIKLVETAKIPVTVQTTYKGTGNY
NVRVTNVISPGDLKIAIWSDKNNQDDLKWYTVAPKNHEATLTFNVTNHRDNGKYFIHVYQ
ENASNQKQLLVKTSLQVAHSNYNTPYFSQRDGRWASRRYGMATLGETGCVPTSLAMILSS
LKGETVLPTQIADYLYHKTVEFNRGVQGTTSRGILKAAKEWGVTATALGTQANLVQALKD
GYHVLAAVQNNVFVLHGSHEIVLKGYNNGLTHVSDPYTPSLSGWYPISQLWKEQSYYSED
RIDIGAPFVKVTDA
Download sequence
Identical sequences A0A2I2AIS9
205921.SAK_1293 WP_001247516.1.100367 WP_001247516.1.100766 WP_001247516.1.101222 WP_001247516.1.101267 WP_001247516.1.10371 WP_001247516.1.12166 WP_001247516.1.12688 WP_001247516.1.12755 WP_001247516.1.12978 WP_001247516.1.1437 WP_001247516.1.16535 WP_001247516.1.1760 WP_001247516.1.18450 WP_001247516.1.19892 WP_001247516.1.20188 WP_001247516.1.20847 WP_001247516.1.21525 WP_001247516.1.22004 WP_001247516.1.26056 WP_001247516.1.26791 WP_001247516.1.27880 WP_001247516.1.29163 WP_001247516.1.29238 WP_001247516.1.30703 WP_001247516.1.30710 WP_001247516.1.31888 WP_001247516.1.32728 WP_001247516.1.34475 WP_001247516.1.34906 WP_001247516.1.36095 WP_001247516.1.36408 WP_001247516.1.36878 WP_001247516.1.37523 WP_001247516.1.39386 WP_001247516.1.3963 WP_001247516.1.41399 WP_001247516.1.41663 WP_001247516.1.41785 WP_001247516.1.42844 WP_001247516.1.44727 WP_001247516.1.44746 WP_001247516.1.45 WP_001247516.1.45150 WP_001247516.1.45976 WP_001247516.1.47485 WP_001247516.1.48239 WP_001247516.1.5055 WP_001247516.1.51114 WP_001247516.1.51780 WP_001247516.1.52470 WP_001247516.1.54818 WP_001247516.1.56602 WP_001247516.1.57721 WP_001247516.1.57900 WP_001247516.1.59565 WP_001247516.1.5977 WP_001247516.1.61790 WP_001247516.1.65323 WP_001247516.1.68788 WP_001247516.1.68827 WP_001247516.1.69023 WP_001247516.1.69101 WP_001247516.1.69132 WP_001247516.1.70276 WP_001247516.1.70397 WP_001247516.1.71554 WP_001247516.1.7586 WP_001247516.1.79135 WP_001247516.1.81168 WP_001247516.1.81506 WP_001247516.1.83616 WP_001247516.1.83944 WP_001247516.1.84227 WP_001247516.1.852 WP_001247516.1.86532 WP_001247516.1.87033 WP_001247516.1.87307 WP_001247516.1.887 WP_001247516.1.89248 WP_001247516.1.89303 WP_001247516.1.90530 WP_001247516.1.90666 WP_001247516.1.90941 WP_001247516.1.91002 WP_001247516.1.933 WP_001247516.1.9386 WP_001247516.1.94532 WP_001247516.1.95950 WP_001247516.1.97850 WP_001247516.1.99241 gi|406709658|ref|YP_006764384.1| gi|76788705|ref|YP_329906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]