SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 208435.SAG1206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  208435.SAG1206
Domain Number 1 Region: 582-671
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000405
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 208435.SAG1206
Sequence length 854
Comment (Streptococcus agalactiae 2603)
Sequence
MRPIVRKKMYKKGKFWVVAGIVTILGGSAILGQDVKAEQAEAVTSTISEKTDSSQTISDT
SKLTLPVNSSEAMKNSAEPLIKTAFATSVSSNPREIAATPVKTFDASSKVVVKASTAEHS
ANQTNSNVNQVANDSEVITQQNSTKQLPTVTYSAHVQDIGWQKSVDNATVSGTVGQEKQV
EAIKLSIKAPEGITGKLSYKTYVKGQGWQPSVESGQVSGTVGQSRPIEALSINLTDNLQK
LYDVYYRVHVQDIGWMAWAKNGAYAGTLGMSKRLEAYEVKFTLKGQSVLTPTIPKEERPV
LNYQVKVGQNGWQSNKLEGQMAGTLGESKALDGVKFTLSTLKYGDILYRTHVQDKGWGEI
LGSQTSKDYQGKRLEAIQLDLSGNLKQNYDIYYRAHVQDKGWMAWQKNNSVAGTVGESKR
LEALEVKLVAKASDFSSQTNHSFLEMKHPGLSYQTYLQKDGWKPTVLEGQLGGSIGLSKS
IKAIKLNLGSTALGNIEYRTFLNGSGWQTVVNSGRESNVPNESQQVEAIQMRLTGLLSKT
YSVMYRVHMQDYGWQDWTYNNDIAGSTNQGKRIEAIEIKLVETAKIPVTVQTTYKGTGNY
NVRVTNVISPGDLKIAIWSDKNNQDDLKWYTVAPKNHEATLTFNVTNHRDNGKYFIHVYQ
ENASNQKQLLVKTSLQVAHSNYNTPYFSQRDGRWASRRYGMATLGETGCVPTSLAMILSS
LKGETVLPTQIADYLYHKTVEFNRGVQGTTSRGILKAAKEWGVTATALGTQANLVQALKD
GYHVLAAVQNNVFVLHGSHEIVLKGYNNGLTHVSDPYTPSLSGWYPISQLWKEQSYYSED
RIDIGAPFVKVTDA
Download sequence
Identical sequences A0A0H1FX05 Q8DZA3
NP_688215.1.71890 WP_001247520.1.100037 WP_001247520.1.13064 WP_001247520.1.14429 WP_001247520.1.1696 WP_001247520.1.19950 WP_001247520.1.24441 WP_001247520.1.26258 WP_001247520.1.30200 WP_001247520.1.30831 WP_001247520.1.32053 WP_001247520.1.3691 WP_001247520.1.3937 WP_001247520.1.4323 WP_001247520.1.45103 WP_001247520.1.49278 WP_001247520.1.56930 WP_001247520.1.62362 WP_001247520.1.67759 WP_001247520.1.70562 WP_001247520.1.73439 WP_001247520.1.77757 WP_001247520.1.83071 WP_001247520.1.8340 WP_001247520.1.93080 WP_001247520.1.93825 WP_001247520.1.9711 WP_001247520.1.97836 WP_001247520.1.98370 208435.SAG1206 gi|22537364|ref|NP_688215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]