SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 211110.gbs1279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  211110.gbs1279
Domain Number 1 Region: 582-671
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000523
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 211110.gbs1279
Sequence length 854
Comment (Streptococcus agalactiae NEM316)
Sequence
MRPIVRKKMYKKGKFLVIAGIVTILGGSAILGQDVKAEQAEAATSTISEKTDSSQTISDT
SKLTLPVNSSEAMKNSAEPLIKTGFATSVSSNPREIAATPVKTFDASSKVVVKASTAEHS
ANQTNSNVNQVANDSEVITQQNSTKQLPKVTYSAHVQDIGWQKSVDNATVSGTVGQEKQV
EAIKLSIKAPEGITGKLSYKTYVKGQGWQPSVESGQVSGTVGQSRPIEALSINLTDNLQK
LYDVYYRVHVQDIGWMAWAKNGAYAGTLGMSKRLEAYEVKFTLKGQSVLTPTILKEERPV
LNYQVKVGQNGWQSNKLEGQMAGTLGESKALDGVKFTLSTLKYGDILYRTHVQDKGWGEI
LGSQTSKDYQGKRLEAIQLDLSGNLKQNYDIYYRAHVQDKGWMAWQKNNSVAGTVGESKR
LEALEVKLVAKASDFSSQTNHSFLEMKHPGLSYQTYLQKDGWKPTVLEGQLGGSIGLSKS
IKAIKLNLGSTALGNIEYRTFLNGSGWQTVVNSGRESNVPNESQQVEAIQMRLTGLLSKT
YSVMYRVHMQDYGWQDWTYNNDIAGSTNQGKRIEAIEIKLVETAKIPITVQTTYKGTGNY
NVRVTNVISPGNLKIAIWSDKNNQDDLKWYTVTPKNHEARLTFNVTNHRDNGKYFIHVYQ
ENASNQKQLLVKTSLQVAHSNYNTPYFSQRDGRWASRRYGMATLGETGCVPTSLAMILSS
LKGETVLPTQIADYLYHKTVEFNRGVQGTTSRGILKAAKEWGVTATALGTQANLVQALKD
GYHVLAAVQNNVFVLHGSHEIVLKGYNNGLTHVSDPYTPSLSGWYPISQLWKEQSYYSED
RIDIGEPFVKVTDA
Download sequence
Identical sequences Q8E4W4
211110.gbs1279 WP_001247505.1.101319 WP_001247505.1.10618 WP_001247505.1.21669 WP_001247505.1.25647 WP_001247505.1.35216 WP_001247505.1.3930 WP_001247505.1.43138 WP_001247505.1.45790 WP_001247505.1.48557 WP_001247505.1.49082 WP_001247505.1.49421 WP_001247505.1.50874 WP_001247505.1.53087 WP_001247505.1.5451 WP_001247505.1.55655 WP_001247505.1.57262 WP_001247505.1.59460 WP_001247505.1.5999 WP_001247505.1.62276 WP_001247505.1.63508 WP_001247505.1.64713 WP_001247505.1.65668 WP_001247505.1.6986 WP_001247505.1.70897 WP_001247505.1.75293 WP_001247505.1.78006 WP_001247505.1.78292 WP_001247505.1.80046 WP_001247505.1.82501 WP_001247505.1.84119 WP_001247505.1.84273 WP_001247505.1.87395 WP_001247505.1.87697 WP_001247505.1.88248 WP_001247505.1.88296 WP_001247505.1.88344 WP_001247505.1.89132 WP_001247505.1.90411 WP_001247505.1.93881 WP_001247505.1.96943 gi|25011328|ref|NP_735723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]