SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 212717.pE88_34 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  212717.pE88_34
Domain Number 1 Region: 879-991
Classification Level Classification E-value
Superfamily Collagen-binding domain 4.97e-32
Family Collagen-binding domain 0.000076
Further Details:      
 
Domain Number 2 Region: 754-868
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.06e-18
Family Collagen-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 212717.pE88_34
Sequence length 991
Comment (Clostridium tetani E88)
Sequence
MKKKFIKMLCSIAIGCMISTSYSIKVSAFSNGNTKTNPNGEFKSLSLNSTNPYKTKYSFN
DLNKLSNKEILDLTSKIKWSDISDLFQYNKDSYTFYSNKERVQALIDGLYEKGCNYTSTD
DKGIDTLVEILRSGFYLGYYNDSLKYLNDKSFKDKCIPAMIAIENNKNFKLGENGQDTVV
HALGKLIGNTSCNDEVVNKTIPILEQYYNEIDKYSKDRLKSNAVYNFMKEINYDISQYEY
AHNIRDYKNTPWSGKIDSFIDTISKFASISNVTKDNGWIINNSIYYTAKLSKYHSNPSIP
HSVIDNCIEIFPDYSEQYFTAIEAIKEDFNSRDSKGNVIDINKLIEEGKKHYLPKTYTFD
NGKIIIKAGDKVEESKIQKLYWASKEVKSQFHRIIGNDKPLEVGNADDILTIVIYNNPEE
YKLNKTLYGYSVDNGGIYIEGIGTFFTYERTPQESIYSLEELFRHEFTHYLQGRYLIPGL
FNKGDFYKGNNGRITWFEEGSAEFFAGSTRTSVLPRKSMVGGLSKNPKERFNADKLLHSK
YSDGWDFYKYGYAFSDYMYNNNKKLFSDLVSTMKNNDVKGYEALIEESSKDSKINKDYEY
HMENLVNNYDNYTIPLVSDDYMKQYDNKSLHEIKSDIEKAMDVKNSQITKESSQYFDTYN
LKATYTLSSNKGEISNWNYMNNKINEALNKLDNLSWGGYKTVTAYFSNPRLNSNNEVVYD
IVFHGLLSHNKNSNEKVEVKEEPEIKDKDSFENVIYEKENNDSFDKANKIHKNQIVMATL
DTEDYRDTFYFDALTSGSIDITIENIHGNSDAFNWLVYNDEDLNNYIAYPTKKEDNKLMG
SFKVHKPGRYYILVYKTSLNKVNYKLNISDATNMAPVIKKIHEKENNDSFETANKITLDT
LVLGNLDYKDVSDIYSFDIENTKDLNIKLTNLNNLGIAWNLYKESDLNNYIAYGAKSDNA
IVGKCNLSPGKYYLYVYKYSGDKGNYSVIIN
Download sequence
Identical sequences Q899Y1
gi|28373190|ref|NP_783761.1| gi|28373190|ref|NP_783761.1|NC_004565 212717.pE88_34 WP_011100838.1.27827 WP_011100838.1.49058 WP_011100838.1.83101 WP_011100838.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]