SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 214684.CNI02220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CNI02220
Domain Number 1 Region: 844-944
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.88e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 173-279
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 3 Region: 1198-1282
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 677-767
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 5 Region: 740-833
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000113
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 994-1082
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 7 Region: 338-424
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 8 Region: 592-672
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Weak hits

Sequence:  214684.CNI02220
Domain Number - Region: 497-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 214684.CNI02220
Sequence length 1289
Comment (Cryptococcus neoformans var JEC21)
Sequence
MAFSAADLQKQHQELEGAPDPFPALAHAPTPVAKKVQSAPAPLDTSSEDAFPSLAAPSAP
SSKGNAKPAISMWASKSSAVKTGATRPMAPGGLGRTGTPTAGSHPFAETFSIPANELVQG
KAASDVVKKVQDQTGAIVESSTQMRTGLKTFHVKAADQKKLAQAKRMIEGGLRKPVTVQV
EVPITTLGTIIGPKGATLKGITDATGAKVDVPRRETLPSYIPKDNGSDAGSDDEDGEPQV
SITISGPATGCADAKDRILSLISHKVSQTSASIKTIPSAFYTIISTQVSELEQGPGEGKV
TVKIPTPAVWKALERQAQADAEGEKVVVDGEAPIKVKGDRENVKAVVDEITKSYDSLVQS
FNLKKVSIPKRQHRFLIGSAAEDILAQTGCVVELPPVDDPSDRVVIRGPQAKLVAAQSLV
FEKANAVSVEPLDLVSVFRRTTSDPVTHATNILRYLRASKLKGVSSAHPNVQIFPPFPST
VANTGAVIIEIVGEDGEEVSKVVDEITSLAKGVLPSAVSIVQVDHLAHSLLVGKKGTRIA
QFEKAHNLTVVFPPASEESSNVLLVYTGPAGKDVKLEEVFEGASKDLTELAKEVADIKTE
ILEVEKKWHKYIIGQSGSVLNAIIGEDALVSVKVGASPTKFPSTGSEDSVTIRGPRNEVD
RVTKQIKQVVEDAKNDDIVNGYTVKFDVEKKYVPHLVGQAGAAINKLRETLGVKVNFEDA
PEKETKKGPKKVLVNCSIVGRKEPVEEAKKRLIAQIEKLEDETTEVLSIKRAIQPALIGA
GGKYAIRLEEKYGVKLSFPRDSKDKESGANPDQVTIRGGRKGVAAAKAELLEAAAFETES
RQEATFKVPSKAVAQIVGKGGATINAIKNDTGAQIDIEREGGEDKQTTITVRGDKQAIAA
AKEAVLNVVKEIGDEITVELTIEQKYHRNLIGQGGQNLRDLIASAGGPSEGYKQAGLVTF
PKNGDETTDKVRLRGDSKVVKKIQAELEKQVAVLKETIVIGVVVPAAQHATKIGRGGMAL
QDLQRKTGAVIHFPGSRQYSSVGEIENLDELEGVSEGDIVKVIGTKEVTQKAAELLQITS
ERGQRNDSRQGRATPDLVSCPVSIPNKYYHAIAETPNLIRQIRAIGGYLNIPQPAPAKPS
PKRPEPKSGDDLAAKTARIDLEGDEDVPDVQGEWSLVKNFEGADDEKSEWIVRAKEEDLE
RAVKVLEQALEKAKKATHVGYLTGLPRSAFPRIIGSKGATISRMRLETGADIQVGKEDDL
ITIVGDEESVLQAKDAILSIVSRPGRERY
Download sequence
Identical sequences Q5KBK6
214684.CNI02220 162.m02775 XP_572710.1.95466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]