SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU3999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU3999
Domain Number 1 Region: 224-302
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000314
Family Collagen-binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU3999
Sequence length 503
Comment (Pseudomonas fluorescens SBW25)
Sequence
MKSKKAFMLGAAMAASCFVSAFALAEQYPHLAAQAVKPDIKQSLKAAGKVPATKASAALK
KQLNAGAQLKKPVFAAKAKADSVVEDHSAPAPVTQVKKAGAQPATAVQAALVQGCETTLD
VNELYTVNGVQTGDLLCYHFNLPQTARINALLVGQTAGTDMSLTLFQDDGQGNPIPLGTS
NNPGTGDESLSGVLPAGDYYWFMEANAAVSGSSFQFGVAVNANIDAFEPNDTPDTAFQLP
DTLNYISGNADSLDDVDYFDFTAVRGQSVGIALSADAASGSTRGKWILERFDGSQWVTVG
ANIVSTSIPSPGVGGVVKVRVRPNQHPNEPWSATGKYTLSFGSNPRVDNPDMKGEANVLR
IPYSASDVGYGYMTTQAYRNLTWKMNLSDSTGAPLVGLHPIVYLDQHINPDTGNIVYKAY
SAATDSSGQAGGTINVGTCFGDFQTTFVDYSQGYNNTWRTDFNYGVWRMEVLEYPGIGVG
GENTEFVSFGHLCNQTLLSSTKS
Download sequence
Identical sequences A0A1I7FQY7 C3JYZ4
gi|229591431|ref|YP_002873550.1| 216595.PFLU3999 WP_015884792.1.23922 WP_015884792.1.48276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]