SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 221988.MS0770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0770
Domain Number 1 Region: 2-212
Classification Level Classification E-value
Superfamily CAC2185-like 8.11e-90
Family CAC2185-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0770
Sequence length 213
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MQNLIKKAIEKIRNQVNKQFRRSINRKNQRLLTNHEMSVIASNCNGAFILHDLAEQFRSP
FVNLYLEPADFVKYLQNIHHYMQADLQFIKTDKAYPVGKLEDLTVYFMHYHSEQEARNKW
IERTKRINLDNLFILMTDRDGCRYEDLSAFDKLPFANKIVFTHKKYTEFSSALYIPGFEA
QSQVGDLFEFSGWNGKKFYDQLDYVNWFNTGKY
Download sequence
Identical sequences Q65UI3
gi|52424825|ref|YP_087962.1| 221988.MS0770 WP_011199949.1.101358 WP_011199949.1.33615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]