SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_3794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_3794
Domain Number 1 Region: 180-465
Classification Level Classification E-value
Superfamily Subtilisin-like 4.45e-36
Family Subtilases 0.00054
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.02e-31
Family Collagen-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_3794
Sequence length 613
Comment (Bacillus cereus ATCC 10987)
Sequence
MKIFQKMCTSTVIITTLLGIGGTVNSVHADSIEQQSKLGIEQETDKQIIVKFKADLKFPY
EDGIEKQIQSQTNDKVIEDLLAEYPDVTFTRLFTSVSPEQIQNLEVKAPNNVSTSLLNYY
ILQTQHGGQEEELVDKLKTSSLIEDVYIKKQEKITPPEVQPLSVSFNPNNNPRYEKQGYL
EAAPSGINAPFAWGVRGGNGSDVTFVDMEYGWLLNHEDLVHQNIELMSGRNIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAINQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQILNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNQNTGTKSKDPYSDRIGVLPD
LKSILVNLGYGQRKPNGGNELPVTENXPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
IDSSENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYNAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences Q732W6
222523.BCE_3794 gi|42782844|ref|NP_980091.1| WP_000689207.1.39001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]