SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P4Z9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P4Z9
Domain Number 1 Region: 1891-2189
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-123
Family BEACH domain 0.0000000354
Further Details:      
 
Domain Number 2 Region: 1727-1855
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-25
Family PreBEACH PH-like domain 0.028
Further Details:      
 
Domain Number 3 Region: 2229-2500
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.66e-20
Family WD40-repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 348-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000422
Family Laminin G-like module 0.071
Further Details:      
 
Domain Number 5 Region: 663-772,831-867,900-994,1057-1073,1112-1161,1248-1382,1416-1541
Classification Level Classification E-value
Superfamily ARM repeat 0.0000476
Family PBS lyase HEAT-like repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P4Z9
Sequence length 2505
Comment (Coccidioides posadasii)
Sequence
MSSVLLRPRRQSSPAATERLTSKLRPAIDALAGSIRDSLCLDDALAATESIICLRHAFLD
DAQPLEARDAFRHLRGFQVLLDLLERLAHLYEPKAFDPQQRRAVLALVKEVIGVLGETLK
DHHGNKRYFARRVHGSGEPSFEQILSSLSGKLEENTDGDKDLEVEQFYGGLLAAGLGQQT
VSGLFTSLRKKFDNDIEVLPAAIKEAIEDAIGSSEVVENPEFFGPLLQLWLEQSLELSKY
PIQRLVVPACLGRLAAQSSRNRLALHSTGMLTSLSGLITNSNRNREELALYYELAVVLSS
EGFDNLDDAAELYRKAHGSVEASRFLLATIKSSKEPPLVQFDMSSHGYSSIELPTLGRPF
PPIASAGYTLTVWARFDTFDPKVHTTIFGAFDATQTCFLLAYLEKDTRYLILQTSITGSR
PSVRFKSTVFSPGVWYHICIVHKRPRPISSSRALLFINGELVEQLKADYPQVPASRSGQK
QARIQAFLGTPQDLALRVGKGLSASSWSLASAVLFEEAFTDDIISVLCQLGPRYYGNFQD
CLGSFQTYRASATLNLRNENFHPGKEEHSDIVAVIRQKASILIPENSILLNISPTAVLDG
DASNIDESQLVKSLSRNPARHLNHFLKAGGNSVAINRAVPAINRALTEPQGVAILTGNPV
LSLPQSLDDAAWRIGGCAAVHLNMIEAATTPEHLRLAVEILLESVQDSWRNSEAMEKENG
YGILGILLREKLGITAAIPNAPIKVASVCSNLQERNELAMELLILILKFVGYDFNNPKKS
IIINPLAYRVLLVDLDIWRLGDLPLLEVYYSQFRTFCIESHYHRFNAKRLSRMRVIKRLL
DSLKDGIFTADNIKLFIPAFSCLTTCCMMAEILRSIALFITYSVHNPKPPSRLQNKKSTA
SITRQFRRATAPQFQGRMAVYISKEQIGVELLRTFADIFCASENTANIQKFARTVTNKWL
LYLISEDNADVVIQATRILARLLTVHGSSYTRKFDKSGGFVILRHCLKRWWSLPALWLFC
FAVLFGQDVKSIDMEQGFDRAAFTALLENSEKAKVACPEVFPVITGMLQSALKSFILETR
AVERPEESDDELWLGGSGRREKSNSISGLHEDLLENVVHFLANIHTKCSDFRDFAATSNY
VDELLLVLFPVVVGSDAVNASVELNSRNSSLTFGSDSVVIQPLSNARPVLRTSTVERCGG
EEGGDSFRRGSSFILVSSDKAKYNPSSARLRHVVEPKADVASTVPAHSVVQELLDLVVSV
LMDQLLTRKEFSGLSIFLKMPPGFIEHQVYFESWLQRNILLQIESNVLLNRKALLEPRVL
NNLARLLTQVADAIYEGWFIDGATVTLDFAGPILEYLQKSEVASLKSIRLCSQTIGNIRS
IVFRTVLLRLSETEDAAALSFLKRLTYWQTVLLGSEETQAEHLQLMCYLLYSKIVTEEED
VRLQAAGLWRIIMVQKPTETLAMLSQTSSSLHKRLSTGFQKLVAMDNSSFLRWIDDQRDD
LDCFFFGTLSKVWENFVRQENNKTDDTARNRLSKRKEKLKQWSQTDEANEEIIRRHDVTF
GHWTSNISLSEKLKHQRYAQDQQDDFTFLLSIFSRVYRNLRRENGLLADRSETKWRLDQT
EGRSRMRQRIIPDDTVGKQDYQPKRRATESHPSKSDTRPRSNTDSDGVSITPSEIAAEGL
EEGSLVDDNGDGAGMDDSFEIIEEPKDGEEDYEDKNRKVMRSLHRGDQVQHVCNISRIVG
LEACEGLLILGKDSIYIMDNYFQRPDGEIVNVWQAPREERDPYVRMISGRESSERKYNNG
EHETRSWKWLDVVSVSKRRFLFRDVALEIFFTDGRSFLITLISPPARNELHTWLISRAPQ
TQAASNSSQADDSWRFEALRSQETKPQFFGSKLVNVFGQGGLHPATRKWLKGEMSNFHYL
MLVNTLAGRTFNDLTQYPVFPWVLADYTSEELDLTNPKTFRDLSKPMGCQTPEREAGFRS
RYQSFAEMGDHNAPPFHYGTHYSSAMIVCSYLIRLQPFVKSFLLLQGGTFDHADRLFYSV
PKAWDSASTSNMTDVRELTPEFFYLPEFLLNSNKYDFGLRQNMTQAIDSVELPPWAKGDP
KIFIAKHREALESPYVSRNLHRWIDLIFGFKQKGEAALEAVNVFHHLSYQGARDLDSIDD
PLERLATIGIIHNFGQTPHQVFNKPHPQREEVHHKLNQLDIAAEGLTRLPFALLDTQERV
ASLSFSVKHDRLLCAAAFRLNIPPNYDKYMEWGFSDNSVRFYASDTRRLVGHFEHLHIGQ
LSCALFADSQTLITSGVDCVISVWSYTTTTKSVELHPKASLFGHRTPVALLAVARSFSTI
LSSSKDGRLMLWDLNRLEFVRELPAGEPVDHARINDATGNIMVCRGSRVSLYTLNGALLL
EQVVCDQNEDCILSCAFYEGVSNEWLERELIFTGHRRGLVNVWSKTIRNGRFELDLIRQL
HHVDQVRGDGAVSSTGITYILPLAQAVYTGDEAGSVYEWTCVQRR
Download sequence
Identical sequences C5P4Z9
222929.C5P4Z9 XP_003069934.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]