SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.blr7971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr7971
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.6e-24
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 11-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.46e-20
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224911.blr7971
Sequence length 231
Comment (Bradyrhizobium japonicum)
Sequence
MMGAPMRSLKLDTPKSLSQRVMQRLRQAIIDGEFALGAAISEEMVANSFGVSRTPVREAM
GQLQAQGLVVIRPQVGSFVFTPSADDIAALCTFRIALEPKAAELAFRHDRDGAVATMSEA
IAAMEPAVSARDNIAYGRADAAFHEALFTHCGNRYLVESYQLVSGRVAALRTNLTSPIDV
RTRTSFDEHRKLLDLFARGEFAAFEALMTTHITNSGVVYAKALKVEALKVE
Download sequence
Identical sequences A0A2A6MP22 Q89C27
NP_774611.1.11505 WP_011090694.1.15658 WP_011090694.1.90507 224911.blr7971 gi|27383082|ref|NP_774611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]