SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_3868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_3868
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.24e-36
Family SMI1/KNR4-like 0.00000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_3868
Sequence length 123
Comment (Shewanella piezotolerans WP3)
Sequence
MSETVPVPLELATFEQIVEVEEEILIPLPLALKEYLMEASDVIVGSLEPVTASDPHSHTF
LPEVAAYAWSIGLPREFVPICQRGDAFFFISQEGEVKLWQDDEIEEDSWETFWEWAEDVW
MRS
Download sequence
Identical sequences B8CQS9
gi|212636607|ref|YP_002313132.1| 225849.swp_3868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]