SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3082
Domain Number 1 Region: 112-409
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.29e-90
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000749
Further Details:      
 
Domain Number 2 Region: 408-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-16
Family Glycosyl hydrolases family 32 C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3082
Sequence length 548
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKTLSRTVLTLFVLSFSCLAAIAGEVSFKITKQYLNFPISHKENRGRMTFEVNGKPDLSV
VIRLAPDEAEYWVFKDVSAFKGKTIKITYDGNEKGLSKIYQSDEIEGQAELYKEKNRPQF
HFTTRRGWINDPNGLIYYEGEYHLFYQHNPFERDWENMHWGHAVSKDLIHWTELPDALYP
DHLGTMFSGSAVIDYDNTAGFNKGKTPAMVAAFTAASSDRQVQGIAYSLDKGRTFTKYDK
NPVINSKEKWNSQDTRDPKVFWYAPSKHWVLVLNERDGHSIYTSSNLKDWKYESHVTGFW
ECPELFELPVDGDKNHTKWVMYGATGTYMLGSFDGKVFTPEAGKYCYTTGSIYAAQTFTN
IPASDGRRIQIGWGRISHPGMPFNGMMMLPTELTLRTTKDGIRLVNVPVKEVESLCKPLR
SWKSLSSDEANRHLKEFYDADCLRIKTTIKLSHATDAGFNLFGQRMIGYDMNSNTLNGRF
YSPQDPTSMELSADIYIDRTSIEVFIDGGLYSYSMERRPDTNNREGLHFWGNRIEVKDLQ
VFSVESIW
Download sequence
Identical sequences A0A174L8C2 Q8A373
226186.BT_3082 gi|29348491|ref|NP_811994.1| NP_811994.1.73244 WP_011108622.1.52087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]