SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3173
Domain Number 1 Region: 318-794
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.08e-90
Family Glycosyltransferase family 36 C-terminal domain 0.09
Further Details:      
 
Weak hits

Sequence:  226186.BT_3173
Domain Number - Region: 16-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.1
Family Lectin leg-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3173
Sequence length 815
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKKLYSFFICTLFSLSASSIGTVDYTKGLSVWFDTPNNLDGQAIWLRASGSGANPDKTWE
SRSLPIGNGSLGANILGSVAAERITLNEKTLWKGGPNTSKGAEYYWDVNKQSAGVLKEIR
QAFLDEDKEKAAQLTRNNFNGLAAYEEKDETPFRFGSFTTMGELYVETGLNELRMSNYRR
ILSLDSAMVVVQFDKDGVQYQRKYFISYPDSVMVMKFTANQSGKQNLILSYCPNSEAKSN
LRADGKDGLVYTGVLDNNGMKFAFRIKAIHKGGTLEAENDRLIVKGADEVVFLLTADTDY
KMNFNPDFKDPKTYVGNDPEQTTRIMMDQAVQKGYDELYRNHEADHTALFNRVRLQLNPD
ISSPNLPTYQRLANYKKGTPDYQLEQLYYQFGRYLLIASSRPGNMPANLQGMWHNNLDGP
WRVDYHNNINIQMNYWPACSANLSECTWPLIDFIRSLVKPGEQTAQAYFNARGWTASISA
NIFGFTAPLSSNMMSWNLNPTAGPWLATHIWEYYDYTRDKKFLKEIGYDLIKSSAQFAVD
HLWHKPDGTYTAAPSTSPEHGPIDEGVTFAHAVVREILLDAIQASKELGIDSKERKQWEK
ILDKLVPYRIGRYGQLMEWSTDIDDPEDEHRHVNHLFGLHPGHTISPITTPKLAEAAKVV
LEHRGDGATGWSMGWKLNQWARLQDGNHAYKLYGNLLKNGTLDNLWDTHAPFQIDGNFGG
TAGITEMLLQSHMGFIQLLPALPDAWKNGSITGICAKGNFEISISWKEGQLDKATILSGS
GTPCNVRYGDKTLSFSTVKGKKYEITLVGNLLKLL
Download sequence
Identical sequences Q8A2Y2
NYSGXRC-10436d NP_812085.1.73244 gi|29348582|ref|NP_812085.1| 226186.BT_3173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]