SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3868
Domain Number 1 Region: 159-481
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.35e-75
Family beta-N-acetylhexosaminidase catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 30-158
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 7.07e-23
Family Hyaluronidase N-terminal domain-like 0.037
Further Details:      
 
Weak hits

Sequence:  226186.BT_3868
Domain Number - Region: 531-660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00435
Family Clostridium neurotoxins, the second last domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3868
Sequence length 661
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MRNKFVSLQALALLVIFCLTGSLTRAAVNPKPFVVPELKQWTGKDGNFTPGKDTRIVCTS
QNPELLRIARMFADDYQQMFGQTLSVAQGKATSGDFVLSLSADKKLGEEGYAIKITDRVA
ISAPTPTGLYWSTRTLLQLAEQNQERSLPQGTIRDYPDYPLRGFMIDCGRKFIPMAYLQD
LVKIMAYYKMNTLQVHLNDNGFKQYFEHNWDKTYAAFRLESETYPGLTARDGSYSKKEFI
DFQKQAASNFVEIIPEIDVPAHSLALTHYKPEIGSKEYGMDHLDLFKPETYEFVDALFKE
YLEGDNPVFVGKRVHIGTDEYSNAKKDVVEKFRAFTDHYIRFVEGFGKQAVVWGALSHAK
GDTPVKSENVVMNAWYNGYADPATMIKDGYQLISIPDGLVYIVPKAGYYYDYLNEPYLYK
EWTPAHIGKAVFDEKHPSILGGMFAIWNDHVGNGISVKDIHHRIFSPLQTLSVKMWTGAQ
TGIPYETFNEKRALLSEAPGVNQLARIGKKPELVYERSTVAPGSTSDYPEIGYNYTVSFD
ITGAKESEGTELFRSPNAVFYLSDPIRGMMGFARDGYLNTFPYKVNPGEKATIQIEGNNR
STTLRVNGKVVDEMNTQKLYFNAGKDSMNYVRTLVFPLEKAGNFNSKVQNLKVYNYCVSK
P
Download sequence
Identical sequences Q8A103
gi|29349276|ref|NP_812779.1| 226186.BT_3868 NYSGXRC-11093b NP_812779.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]