SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_4185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_4185
Domain Number 1 Region: 38-313
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.7e-78
Family alpha-L-arabinanase-like 0.0000245
Further Details:      
 
Domain Number 2 Region: 342-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.13e-31
Family Beta-D-xylosidase C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_4185
Sequence length 558
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKRLTQTLAFCLLTVFTAVAQKNYVSEVWVSDLGNGKYKNPVLYADYSDPDACRVGDDFY
MTSSSFNCLPGLQILHSKDLVNWTIIGAAVPYALTPIETPERPEHGNRVWAPSIRHHNGE
FYIFWGDPDQGAFMVKAKDPQGPWTEPVLVKPGKGIIDTCPLWDEDGKVYLVHAYAGSRA
GLKSVITICELNKEATKAITPSRIIFDGHEAHQTCEGPKFYKRNGYYYIFHPAGGVPTGW
QVVLRSKNAYGPYEWRTVLAQGDSPVNGPHQGAWVDTPSGEDWFFHFQDVGAYGRLVHLQ
PMKWVNDWPVIGIDKDGDGCGEPVMTYKKPNVGKIYPICTPQESDEFDGYILSPQWQWHA
NINEKWAYYAGDKSYVRLYSYPVVADYKNLWDVANLLLQKTPSDNFTTTMKLTFMPNPKL
KGERTGLVVMGRDYAGLILENTDKGLVLSQIECKKADKGEAEQVNSSVGLTQNTVYLKVR
FSCDGKKIKASEGGNDLIVICNFSYSLDGKKFLPLGNPFQAREGQWIGAKVGMFCTRPAI
VTNDGGWTDVDWFRITRK
Download sequence
Identical sequences Q8A036
226186.BT_4185 gi|29349593|ref|NP_813096.1| NP_813096.1.73244 WP_011109159.1.29471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]