SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226900.BC2466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226900.BC2466
Domain Number 1 Region: 343-439
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.8e-28
Family Collagen-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 218-329
Classification Level Classification E-value
Superfamily PKD domain 9.42e-19
Family PKD domain 0.00085
Further Details:      
 
Weak hits

Sequence:  226900.BC2466
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0942
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226900.BC2466
Sequence length 440
Comment (Bacillus cereus ATCC14579)
Sequence
MYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAKQTLFAKYGSWDF
YKYSFALQSYLYNHQFDTFDKLQDLIRANDVKNYDAYRELLSKNTQLNAEYQAYMQQLTD
NQGKYNVHQVTNDYLIQHAPKPLAEVKNEIVDVANIKDAKITKHESQFFNTFSVEGTYVG
GISKGESEDWKTMSKQVNQTLEQLSQKGWSGYKTVTAYFVNYRVNAANQFEYDIVFHGVA
TEEKEKTTTIVNMNGPYSGIVNEEIQFHSNGTTSENGKVISYLWNFGDGITSTKANPTHI
YGEKGTYTVELTVKDSRGKESIEQTKVTVKQDPQTGGSLEEEKILPFNTLVKGNLVTPDQ
TDVYTFNVTDPKEVEISVVNEQNIGMTWVLYHESDMQNYVACGEDEGNTIKGKFVAKPGK
YYLNVHKFDDKNGEYSLLVK
Download sequence
Identical sequences Q81DA6
gi|30020596|ref|NP_832227.1| 226900.BC2466 NP_832227.1.86172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]