SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226900.BC3762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226900.BC3762
Domain Number 1 Region: 174-462
Classification Level Classification E-value
Superfamily Subtilisin-like 2.36e-36
Family Subtilases 0.00051
Further Details:      
 
Domain Number 2 Region: 497-606
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.92e-32
Family Collagen-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226900.BC3762
Sequence length 607
Comment (Bacillus cereus ATCC14579)
Sequence
MCASTVIITTLLGTGGTINSVYADSIEQQSKLGIEQETDKQIIVKFKADLDLPYEDGIEK
QIQSQTNDKIIKDLLTEYPDVTFTRLFTSVSPEQIQNLEVKAPNHVSTSLLNYYILQNQN
SGYEEEIVDKLKASSLIEDAYMKKQEKIMPPEVQSSSVALNPNNNPRFKKQGYLEAAPYG
INAPFAWGIQGGNGNGITFVDMEYGWLLNHEDLLHQNIELMSGRNIDQHVGHGTSVLGIV
SSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQASFDGY
GDKYLPVEVQPDIFDAIRAGTDKGIVIIEAGANGWNDLDQFKDRKGKQVLNRNSKDFKDS
GAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSFSGTSSA
SPIIAGAATLVQSIAKENLGQPYRPSELRAILSNQSTGTKSKDPYADKIGVLPDLKSILV
NLGYEQRKPNGGNELQVTENEPNNEPRQANKVNFHTPVKGMLHNSDRVDVFTFQIDSPEN
INISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYNAKPGKYYLYVYKYENTDG
SYVLNIK
Download sequence
Identical sequences Q81A31
226900.BC3762 NP_833486.1.86172 gi|30021855|ref|NP_833486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]