SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228405.HNE_3441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228405.HNE_3441
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-50
Family Ribonuclease PH domain 1-like 0.0000263
Further Details:      
 
Domain Number 2 Region: 294-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-48
Family Ribonuclease PH domain 1-like 0.0000193
Further Details:      
 
Domain Number 3 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.3e-29
Family Ribonuclease PH domain 2-like 0.00099
Further Details:      
 
Domain Number 4 Region: 452-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.95e-26
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.48e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 622-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.29e-21
Family Cold shock DNA-binding domain-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228405.HNE_3441
Sequence length 713
Comment (Hyphomonas neptunium ATCC 15444)
Sequence
MFNKQSVSLEWAGRTLTIETGQVARQADGAVMVQYGDTIVLATAVFAKEAKPGQDFFPLT
VNYQEKYFASGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFVDGFKHEVQVVVTTLSY
DLENDADIIALVGASAALVLSGAPFMGPIGAARVGYKDGQYIINPTIAELEESELDLVVA
GTTDAVMMVESQAAELSEDVMLGAVVAGHDAMQPVIDAIIALAEKAAKEPFAYEPPDHSA
ALKSVIDTVGADLSKAYKITAKGERYAAIGAAKDKAKAALLGTDEAPGVMTPEVFKTVFK
EAEASVVRGDILKTGQRIDGRKLDQIRPIVAEAGFLPRTHGSSLFTRGETQAICVATLGT
SDDEQYIDGLDGTKKEKFMLHYNFPPYSVGETGRMGGAGRREIGHGKLAWRALKAVLPKH
EDFPYTIRMVSEITESNGSSSMATVCGCSLAMMDAGVPLTRPVSGIAMGLILEGSEFAVL
SDILGDEDHLGDMDFKVAGTENGVTSLQMDIKVAGITKDIMGKALEQAKGGRMHILGEMG
KALTASRGQLSENAPQMEIIKVPTDKIRDVIGSGGKVIRGIVDETGAKVNIDDDGTVQIS
AMDRKSIDAAIKMIKGITAEAEVGEIYEGKVVSMKDFGIFVNFFGPKDGLVHVSQMANKR
IGHPKEMVKEGDKVWVKLMGFDERGKVRLSMKVVDQETGKELAEEAGDDASED
Download sequence
Identical sequences A0A059FN22 Q0BWM9
228405.HNE_3441 WP_011648409.1.33885 WP_011648409.1.6977 gi|114798182|ref|YP_762114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]