SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228908.NEQ412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228908.NEQ412
Domain Number 1 Region: 131-442
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.59e-103
Family Leucine aminopeptidase, C-terminal domain 0.00000194
Further Details:      
 
Weak hits

Sequence:  228908.NEQ412
Domain Number - Region: 57-132
Classification Level Classification E-value
Superfamily Macro domain-like 0.000112
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 228908.NEQ412
Sequence length 443
Comment (Nanoarchaeum equitans)
Sequence
MPTKFYLTDHADGGVIVKFFKDRESVKSYANVDEDFFKRDNAIFVKKDRDYLIVYVKDEW
KAYFLAGRYIKNSPFKEFIIDLREIESKDKAIIGILSTSYIFDRYKSEKQEKIIKFICDD
KEKVKEYITLMEAQYLARDLANEPPNVLNPETYEKKIIEIFKGLPVNIKVLHYDDLIREG
LNLLVYVGKGSIYKPRLVILEYNLKDNPIVLVGKAITFDTGGYSLKPTDYMYNMHGDMSG
SAAVIGALYAIAKNKKDIPIVALIPIAENVISGESYKVNDIIKAYNGKTVEVTNTDAEGR
LTLADAIAYSAKYNPKAIIEVSTLTGGQIIALGHEIAAAMGEKDLVNKAIEAGKEVYELV
WELPLYEGYRELLKSAVADIKNANGREAHAIQGGLFLKEFSPIEKFLHLDIAGPAIANRA
IPSAYKGLTGFGVRLLYKLVQKL
Download sequence
Identical sequences Q74ME1
gi|41615198|ref|NP_963696.1| 228908.NEQ412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]