SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228908.NEQ446 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228908.NEQ446
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.02e-29
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228908.NEQ446
Sequence length 136
Comment (Nanoarchaeum equitans)
Sequence
MKHLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAENIIPGIT
KEIDINVNVFGGGWHSQTEAVRQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQN
KSLRSKPRAWRQTSYR
Download sequence
Identical sequences Q74M88
gi|41615231|ref|NP_963729.1| 228908.NEQ446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]