SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228908.NEQ516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228908.NEQ516
Domain Number 1 Region: 8-81
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000000275
Family Prefoldin 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 228908.NEQ516
Sequence length 83
Comment (Nanoarchaeum equitans)
Sequence
MAEKEVLLQQILMQKQVLEAQLEEINNAIKEIEESNGKVYKILGTYFLEIPKEKALEELN
EKKKLLEIRLDALKKQEEKLKGE
Download sequence
Identical sequences Q74MX1
228908.NEQ516 gi|41615298|ref|NP_963796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]