SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_5510
Domain Number 1 Region: 627-711
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000902
Family Collagen-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 394-475
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000484
Family Collagen-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5510
Sequence length 712
Comment (Solibacter usitatus Ellin6076)
Sequence
MRPGSIVMLGIGVCLVPLHAQDCAAVARILPAGTVSGTLADGQCQLSDGTPYLPFRLDLP
VRGKIKIALTGSSSGSPSDLGLILRDAAGTRIDSGTAIARPIEAGSYTVLLNGSKPGQTG
DYNITTAFTAESGMLCGNFPNLGRRQVARGMLPGSNCQAPDGTPYEAYTLTTDGAGTLTV
TVDSTDFTPVIAVRSSDGHVIAMPAASPVNVLVNGDSQYLVVISSGDKSGTYTITTSFQA
GDTETCRSKKTFTGPDSDTNTIGADSCFLTIAGSGDQSYYNYYNVTVGSSGLVRATVTSG
DFNATVNLLDADGYLLASDAGSGGFDAQFNSISGLRAQLPAGNYRLQVFSDVPSGGAYSL
QYSFTAGNPKPCTPATLNFGDLPAGTLNADSCRSSYGIADIYTVAVPGWGTVDFDMSTAS
FNTSLVIRDAKDNLIVRNDEVDGVSDSHITADLPAGTYTIVAAASSGSGNYRLAVKFTPH
DALPCTYVQALDLNGGFIQRLGRGSCRASNGQPVDYYSFTLAADSLVLAVMTSSEVDGFL
TLTDAAGNVLRTDDNSYGSNDPLIVQYLPAGSYQLAARDSSSTAGGLYEIDLRTTEGARP
PFCMPKATMAQGATATGEIRYTGCQYGDNTFADLYQLTLTADGQVDIRLDSSDFDAYLIL
LDAKGAEMDEDDDSGGNTNARLTRALAAGTYTIVVKPFGDYRDQGKYTLSVK
Download sequence
Identical sequences Q01V58
gi|116624586|ref|YP_826742.1| WP_011687196.1.46729 234267.Acid_5510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]