SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_5711
Domain Number 1 Region: 107-210
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000981
Family Collagen-binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5711
Sequence length 731
Comment (Solibacter usitatus Ellin6076)
Sequence
MSRGTTVEMTVEGLNLARASAIYFSDSGITGRILRVKELPDGSDVRLGSAGTPSSIDLGP
LPPRNQVTVEVEIAPEAEIGPVTFRLLTPLGTSPEGRFLVEPYYGEAADREPNDTAETAV
ETFLPAILSGAISRPGDVDYYKIQVKAGQEISFLNGAMQIGSSLQPVVAIEDAAGKLLRE
FGQRGGVEQLMFAYRFGEAGTYYVRVTDYQHGGRAGAFYRIIAGEFPLVLGATPLGVRKG
AAAEVSLRGYHVASKIPVRGEVTGGSEDTATLRPEHAFNTVRVAVGEEPELTSQGGAIPV
PVTVNGRISARGAENRYRFNARKGEQLVLEVNARRTGSDLDSYLEVLDAQGNPVERAVVR
PVWQTNVTLRDHDSTGRGIRIAAWSGMQAGDYVMLGSEILKIEALPLSPDADTTFEGTGG
QRLTYFDTSAEAHAIDSAVYKVQILPPGSSPSPNGLPVARLYYRNDDGGPGFGRDSMVHF
TAPADGEYQVRIRDVQGLGGDTYGYRLTVRRPRPDFRLTVTPRNPNVPVGGSVPLTVSAL
RMDGFDGPIDVTVLDLPPGLQATRGVIRAGQLSTTLTLTADAEAKLTAATPLEIAGAGAG
ITRMANPEDRMKLIALMPRPDLVMTAETREVTVPQGGTAEITVSIARQAGFHGRVPVEVR
NLPPYVRVLDVGLNGVLITEDETRRSFTIEALPGAEPGDQLIYVSGAVETRSGQPSSYAA
PEAIKLHVAPR
Download sequence
Identical sequences Q01UL2
gi|116624787|ref|YP_826943.1| 234267.Acid_5711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]