SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 237895.Q5CEM3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  237895.Q5CEM3
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000935
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 237895.Q5CEM3
Sequence length 818
Comment (Cryptosporidium hominis)
Sequence
MEVFEIFITRYINYINIWSIELTSENFYEEFRDGILLVNLLKQWSSLYGYNNTEGDLLIY
KRPLNRSQALNNINLCLNFILNPPEKSKLPEYLNGNNELIAAEEIYDMNKGSVIRFISTI
FHHYLIPYLRINSKIIIENVNKYLMLHGLSLTNETKENFYKMIMKKNLNHTEDENLLERA
ESWGQYLSLNIEEMENRDKVKSNHLNEREEEQEKGYIDFNSYNYIKMGQKNNVKNNHVKH
FEPKYINPLQCDITSNGFMLIMVLLYQMGWIDTAILCQMYYVPKTLQEFKWNHEIVYYSF
QTIHKYLSIQKELSIVNHNTSNTKFDNSFLNNENEGDDEVMANITDSEIPFILVPLSSLY
MENFSPYVLLLQIDILYNLLTQQIDSNYDVTSYSSNRLAVYGPYQPINLELLDELTYKDD
YPLNWTMSNCEVNPSEDLIDEIQEEEHEIEQIDDYDYENSENDVSLHANMVKSKNFNINN
TSKSSSDNLARIEAIINESNMINANSKKKLVENNNIHHESYLNNNNIDDNDDDDYVVGSM
YEYLQDKEKEIVTDNTVNNLYEDNIEEVSEYDIGYTYDFKNRNHPSEKKINNKQNVNTPN
DQNNYNKNRYHLNGKVNQAVGETGIDEMFTGLEKELEILKIYDENNFIEKSSKNENNPEN
VNEKNEINNTKSIKQIFQEKMASNTREFQEKFSDVLNKEESYQQTKVKPSISRTALEEQQ
RKILGMVNDDNDYASKVFDITRKQSDGVIEKISTAISENNKLLEKLKMSMNMKSNSNHNN
NSNLQNENKPDFLIDSENNSSASTGKINKEIVLNSIES
Download sequence
Identical sequences gi|67587940|ref|XP_665286.1| XP_665286.1.74355 237895.Q5CEM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]