SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_0142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_0142
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily L28p-like 1.49e-25
Family Ribosomal protein L28 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_0142
Sequence length 78
Comment (Anabaena variabilis ATCC 29413)
Sequence
MSRRCDLTGKKANNAFAVSHSHRRTKRLQQANLQSKRVWWPSGNRWVKLKLSTKAIKTLE
VKGLEAMAKEAGINLNHY
Download sequence
Identical sequences A0A1W5CJI0 Q3MGW8
240292.Ava_0142 gi|75906367|ref|YP_320663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]