SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_0511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_0511
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.38e-61
Family PP-loop ATPase 0.00019
Further Details:      
 
Domain Number 2 Region: 214-332
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 6.02e-20
Family MesJ substrate recognition domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_0511
Sequence length 342
Comment (Anabaena variabilis ATCC 29413)
Sequence
MVWTKLHAKIHRTIRSRHLFERNQRLLVAVSGGQDSLCLIKLLLDLQLKWGWELGIAHCD
HRWRVDSQANADHVKNLSETWGVSFYLETASKPINSEATAREWRYETLSAIAQAYNYEYI
VTGHTASDRAETLLYNLMRGTGADGLQALTWQRPLTENILLVRPLLEITRKQTEQFCQEF
QLPIWEDSTNQDLKYARNRIRQELIPYLQANFNPQAELAIAQTAELLQADVEYLERTAQQ
LKEKAMEWEVGEEFLSPSSPSPFLLRLNRQVLQKAPLALQRRVMRQVLQEILADAPNFEH
IEKLTALITAPNRSQTDPFPGGAIAQVQDNWILFRNGERRNN
Download sequence
Identical sequences A0A1W5CPD3 Q3MFV1
240292.Ava_0511 gi|75906734|ref|YP_321030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]