SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_2076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_2076
Domain Number 1 Region: 3-418
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.7e-182
Family GABA-aminotransferase-like 0.000000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_2076
Sequence length 427
Comment (Anabaena variabilis ATCC 29413)
Sequence
MTRTNSDFLTNSDPAIAGLINQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGL
PGKRYYGGCEFIDKIEQIAIDRAKQLFGAAHANVQPHSGAQANFAVFLTLLAPGDKIMGM
DLSHGGHLTHGSPVNVSGKWFQVCHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYP
RIIDFEKFRSIADEVGAYLLADIAHIAGLVASGLHPDPIPYCHVVTTTTHKTLRGPRGGL
ILTGDAELGKKLDKSVFPGSQGGPLEHVIAGKAVAFGEALKPEFQGYSAQVIENARALAN
QLQNRGLKLVSDGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPQSPFVTS
GLRLGSPAMTTRGMGEAEFTEIGNIIADRLLNPDSDTVAQDCKRRVAALCDRFPLYPHLE
IPVPVLA
Download sequence
Identical sequences A0A1W5CHU3 Q3MBD8
240292.Ava_2076 gi|75908297|ref|YP_322593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]