SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_2295 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_2295
Domain Number 1 Region: 278-346
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 3.27e-17
Family TonB 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_2295
Sequence length 507
Comment (Anabaena variabilis ATCC 29413)
Sequence
MTFSGYNVEQRSKEVKALQSFLTYSFIGSMALHIGLLASGLGNFLARIPQVEEEPIEIAI
VDPVTAEVEKAPEAVLAEPKIDNASGGGSQGGGGGSSSEISIATKPQVVNQVRPVPKVVD
NFKTPQVQQQPQKTITSIEKAEPVNKLSQEIATEPQAPTKSAIVNPSTNQSSDNLRRLLS
GLRNSQTVQGNVATGTGSSLASGSGSSTGNGIGSGIGRGIGSGTGNGVGSGTGNGSGTGT
GSGTGNVQAIATTSTPPKIRTEPRENNRSGNGRAACRECNARYPEAARRRGIEGRVEVAV
DTDSQGNVTGARIARSSGNRELDEETLRQARNWKLKPAEGGRQGVAIATEFALQGSRRHR
QVQEQKKRREAEARSQQTTAANNDATEGTRRRRRLVTSTEANTPAPTSSETRVRRTSEST
SERPSTPASATRTGTARESLRRIRRERTTNNSAQEAPQTPTPTRRQRRENAQSASQDKLR
ATLRGLRQPAQPAPAAPPASTTPANQE
Download sequence
Identical sequences A0A1W5CC40 Q3MAS3
240292.Ava_2295 gi|75908512|ref|YP_322808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]