SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_2352 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_2352
Domain Number 1 Region: 26-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.014
Further Details:      
 
Domain Number 2 Region: 333-436
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000179
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 437-517,569-594
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000267
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Weak hits

Sequence:  240292.Ava_2352
Domain Number - Region: 532-666
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000254
Family Filamentous hemagglutinin FhaB, secretion domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_2352
Sequence length 820
Comment (Anabaena variabilis ATCC 29413)
Sequence
MKLTLVGFGFLGIFCLSAVDNNCVYAQVIPDHTLKTSVSGSNPYIITDGTRIGNNLFHSF
SQFSILKGDSASFDNAIDIQNIFSRVTGGNISNIDGSISANGNANLFLINPAGIIFGQNA
SLNIGGSFVGTTAETITFADGKRFSSTDTDTSPLLTMNVPTGLQFGSNSGGITVQGTGHN
AQLSDSLQVSGLNLSTRGLQLQPGKTLGLLGSNIALDGGLLSAPGGLIELGGITSGNVIL
NSTPQGFAFQYSQVPSFGNLQITQRALASTRDFNGESGGAIHIQGKQVSIRDGSLILVQN
RSQKTAGDIAVDASESLELIGKSPDFQSSSSLVNESTSSGKAGNIIINTPRLNIDQGGYI
YNRTFSTAPGGNIIVNTDETRVNGFAYGDPSAFRAVSQILAASYAGGKGGNISVSTQKLS
VLAGGNIAARPYAGGNGGDVTVKADTIEVDNTGSPTGFYFSLISTATFGSGNAGNLALDT
RKLSVQAGGRVSASSIILGNAGVLTINASESIDVSGVKDADNPSYIGTAVRPFGAFARTS
RANSGNTTINTPVLNVTDRATVFVENSGLGTAGTLQINANTLKLDNHASILASTKAGEGG
NINLQLRDVLLMRHGSFINAEAGSNGNGGNISINSPNVVGLENSDIIANAVQGKGGNIQI
TTQGIIGLEYRNLLNPREILSNDITASSQFSISGTVQINNVGVDPNSGLIDLPTNLSDPS
QQVATGCSNTNSSSFVATGRGGIPQNPTQQMRSDRTWSDIRDISAFHTKELAQAQIPQSP
EKLVQATSWHRNAQGKIELVAAKSSSQMSPTLTCAAAPQN
Download sequence
Identical sequences A0A1W5CC09 Q3MAL6
240292.Ava_2352 gi|75908569|ref|YP_322865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]