SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_3985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_3985
Domain Number 1 Region: 34-156,183-411
Classification Level Classification E-value
Superfamily Thiolase-like 6.08e-105
Family Thiolase-related 0.0021
Further Details:      
 
Domain Number 2 Region: 1594-1714,1775-2000,2032-2052
Classification Level Classification E-value
Superfamily Thiolase-like 5.01e-88
Family Thiolase-related 0.0025
Further Details:      
 
Domain Number 3 Region: 564-694,758-861
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.97e-76
Family FabD-like 0.00036
Further Details:      
 
Domain Number 4 Region: 1202-1442
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.58e-29
Family Tyrosine-dependent oxidoreductases 0.0017
Further Details:      
 
Domain Number 5 Region: 960-1190
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.28e-21
Family Tyrosine-dependent oxidoreductases 0.027
Further Details:      
 
Domain Number 6 Region: 1474-1548,1580-1610
Classification Level Classification E-value
Superfamily ACP-like 3.14e-16
Family Acyl-carrier protein (ACP) 0.021
Further Details:      
 
Domain Number 7 Region: 693-757
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000327
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_3985
Sequence length 2551
Comment (Anabaena variabilis ATCC 29413)
Sequence
MSHTSDINQLSPLQRSVLALKEMRAKLDAVENAKTAPIAIIGMNCRFPGGADYPEKFWEL
LHNGVDTITEVPADRWDVDEYYNANPNTLGKIYTRYGGFIKQVDQFDPHFFGLSPLEAAS
MDPQHRLLLEVGWEAIENAGQSPEELNGSQTGVFMGLFMEDYSRFNLYSGDHHRIDAYSS
LGNARSIAIGRLAYVLGLQGPVMQLDTACSSSLLAVHLACQSLRSGECNMALAGGVNLIL
APEASIGLSRMRALAPDGRCKTFDAKADGYVRGEGCGIVVLKRLSDAIANNDNILAVVRG
SAVNHDGASSGLTVPNGLAQEKLINQALTNAKVAPEQISYVETHGTGTSLGDPIEVRALG
SVLCQGRSPEQPLLIGSVKTQLGHLESAAGVASLMKVVLALQNAEIPPHLHLQQPSPHIP
WDKLAVAVPTKPTPWPAVNGKRLAGVSSFGMSGTNAHLIIEEAPELKLELPKTERPLHLL
SLSAKTEAALLAMASRYESFLTSHPETSLADICFTANTGRSHFEHRLAVVAASNADLREQ
LTAFASQKQTSTSVSGQVQKKRSKVVFLFTGQGSQYVEMGRQLYETQPTFRKTLDRCDEI
LRPYLQQPLLSVLYPTSDVTSPLNETAYTQPALFALEYSLAEMWKSWGIVPDAVMGHSVG
EYVAACVAGVFSLEDGLKLIAERGRLIQSLPQNGMMAAVFTNEARMNGILAAYTGQVAIA
GINGPENIVISGAREAVQSVLKELATQGINAQPLQVSHAFHSPLMASILDPFEQIASSVQ
FQAPRIPLISNLTGQILKPNEIPHAAYWRQHLREGVRFYAGIKTLHEQGYEIFVEMGPST
TLVGMGKRCLPEGAGTWLTSLKKGQPDWSQLLASLSELYIRGIKINWTAFDQGYQRRRLA
LPTYPFQRQRYWVENLSPNLSPTRREALNSPPSLQGKGAGGLGFTSAIPPKALPKIPLSV
PSNWFHSWQWTPEVLSQSQDIPSGAILIFSDRHQVGENLAKLFDAKKYTTYFVTPGESFT
QTAGHFTINPASVADYEQLIQNIKAQGVTVTAAVHLWNYSLWATSPEQLLENDRLLNERV
YSLLFLTQALVKHYPASPLNFLVVTQGAYPISPNDSLHGVHQSMAGVLAQVVAQENPQIQ
AKVVDFNQDVYLPEKLADILFQEMKATPTGEGIVAIRDGQRLSRTLAKINVPTENNSLPL
SAGETWLITGGTSAVGTEIALAMVRQVPINLVLTGRHPLPPKQEWQSASHDASTQQRIQA
IQQLEQLGATVMYQAVDVTDALGMKQLIESIKSRFGNLDGVIHAAGAVDHSTFKLLQKQP
ASVTKVLAPKVQGTIILDTVTRNEPLKYFVLLSSVSASKAEWGTGMGDYAAANTFLDSYA
IYRTQHGGQGRSLALNYSLWSDRGMGALLGASTLLMVRSKGLNPLEPEPAANAFIQALSL
DASPVIHIIDLIAQATPEIAPKSSASQSQAKPRNLRQLVREVLLQHLRIPEAQVEGHKTF
QEMGLDSVGTVEVVQHLGTTLGEELFPTLLFEYQTPDDLVDYLQSKYGYSVKTSTSAMDY
APPLVIAPEETSSPQTEKSAPPNVAPQEKYQDVPEQDIAIIGMACKIPGADNLEQYWDLL
NAGRSVIQDVPQDRWFNQHYFEAKGNSPQAKISKRGCFVNSPFDFDPMFFGISPKEATAM
DPQQRLFLELSMQALQQAGYGGKYRPDNIGVFVGCGQNTYIEHFTNYQYYEELRQRLQES
SWFDHLPAEDRQHLLKTLSQVLQPSEILPESAAGNEVNELAARVSHCLNLKGPSMAVSTA
CSSSLVALHIACESLRSGQTGMAIVGGVNLNLSPSPFTFLRKAQALSLSGTCYPFDRRAN
GIVLGEGAGVLIIKPLKQALADGDLIHAVIKGSAVNNDGHSQGITAPNPKGQAEAIRQAY
NSCGVDPRTISYIETHGTGTLLGDPVEVEGMTKAFRSFTDEKGFCTIGSVKSSIGHLLSA
SGIVSLIKVVLAMQHGKIPQTVGFEEPNPHINFADTPFTVAGKSIPWSPNGNPLRAGVNG
FGFGGTNCHVILEESPVAANLQSQVTSSAPDLLCLTARNQQALQEVARQLRQHIIHHPEQ
ESSQICFTQNNAQKELPYKAALVVNDRQHLLNYLEAICSAQTPADIYTGRANPQRTTPFH
LILDGTSAIAPAEIETLGQRFPQFQVAYNSVRAGFHEMSEQAHIFAVQYAWGRLLMSLEL
QPTSLLVEKTGILAGATLRGMLTLEQAIALLLQIEGEKGLSVHDVSAKEQSASTWTCPLV
TSQGIFSHADTISTDQLLALVQVSEQLNVDVCQDVISKESVYLHLGDSFALKEQLASLDE
LGVWIYLNKRQPVVERVLTSLARSYVAGIRFNSIPLFPQGLRRVLLPTYPFERKTYRVSL
VDHTQENQATSIPAAELLPPRPESKHQLTVAQTRLLPIEQLSPLTDNQRQSSYAKLTEDL
KIVDNRQQPRLVPMEQLSPLTDSQRQSSYAKLIEDLKIVDNRQQPRHPVAVTQNRLLPME
QLSPLTDSQRQSSYIKLAQDLQKFGKSVIGH
Download sequence
Identical sequences Q3M5Z6
240292.Ava_3985 gi|75910189|ref|YP_324485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]