SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4108
Domain Number 1 Region: 8-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.62e-116
Family Acetyl-CoA synthetase-like 0.0003
Further Details:      
 
Domain Number 2 Region: 695-1065,1097-1118
Classification Level Classification E-value
Superfamily Thiolase-like 6.08e-110
Family Thiolase-related 0.0022
Further Details:      
 
Domain Number 3 Region: 1223-1352,1416-1521
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.06e-75
Family FabD-like 0.00057
Further Details:      
 
Domain Number 4 Region: 598-711
Classification Level Classification E-value
Superfamily ACP-like 1.07e-18
Family Peptidyl carrier domain 0.037
Further Details:      
 
Domain Number 5 Region: 1352-1415
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000314
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4108
Sequence length 1656
Comment (Anabaena variabilis ATCC 29413)
Sequence
MITNDNVEFSTLVDLLRYRAQNQPTQTAYTFLVDGETESISLTYQELDQKARAIATQLLQ
RGVPGSRALLLYPPGMEFIPAFFGCLYAGFIAVPAYPPRRNQKMSRLQAIVSDAEAVVAL
TTSTELTSMALQLAENPTLTAIPWITTDNLNANIAEDWQQPNINSDTLAFLQYTSGSTGT
PKGVMITHGNLLHNSQLIYNFYQHTPNSQGVIWLPPYHDMGLIGGVLQPLYGGFPVTLMA
PVAFLQKPFRWLQAISHYKATTSGGPDFAYDLVCRQITPEQLASLDLSSWEVAFTGAEPI
RAQTLDRFAETFAPCGFRREAFYPCYGMAETTLIVSGGWKSEAPIVRHIDTTALLQNQVI
DTTTAAGGKAIVGCGKSSPDQTVLIVNPESLTSCADGQVGEIWVSGSSVAQGYWNRPEQT
QHTFHAYLADNTTGPFLRTGDLGFLQDGELFITGRLKDLIIIMGRNHYPQDIEFTVESCH
PALRPAGGAAFAVEVNNVEKLVIVQEVERSYLRKLNADEVIGAIRKAVAEHHDLQTHTIA
LIKTNSLPKTSSGKVRRSNCKAELEAGSLDIIAQWSADAQNHSPSEKLIAPQVEKTVNTE
AVATWLLTKVSEQLQVPAQTINVNEPLAQYGLGSLAAVRISGELQEWLGRELPTTLLYDY
PSIAALAQYLGDGVPQPKVVSQQPTDNHAIASGGAAPIAIVGIGCRYPGANNPEAFWQLL
RNGVDAISEVPQQRWDVNSFYDPNRATPGKMNTRWGGFISEVDQFDAPFFGISPREAESL
DPQQRLLLEVCWEALENAGKAPSKLAGSNTGVFVGISNFDYSQLLAKQVSGLDAYSGTGN
AFSIAANRISYLLDVHGPSWAVDTACSSSLVAVHQACQSLRQGECEMALAAGVNLILTPQ
LTVTFSQAGMMAGDGRCKTFDADADGYVRGEGCGVVVLKRLSDAYRDGDRILAVIKGSAV
NQDGRSNGLTAPNGLAQQAVIRQAMQNAGVAPHEIGYVEAHGTGTFLGDPIEVNSLKTVL
APGRAPGDTCVIGSVKTNIGHLEAAAGIAGLIKTVLSLHHEEIPPHLHLKQVNPHISLAD
TNLSIATTLLPWNRGNKRRLAGVSSFGFGGTNAHIILEEAPLVSPKDTVSDERPLHLFTL
SAKSENALRDLAKDYENYLGNHPDASLTDICFTANTGRSHFDHRLVAIAQSNIQLQTVLG
AYATGKKTSQLVSGKIENKQQPKIAFLFTGQGSQYINMGRQLYATQPTFRAAIDQCEQVL
RSYLDQPLLSVLYPDTESSCIDETAYTQPAIFAVEYALAQLWKSWGVEPTAVIGHSFGEY
VAACIAGVFSLEAGLKLVTERSRLMQALKSMGAMAAVFASEEQVQAAIAEYSPEVTISAV
NAPDNITISGTVAKIAAAIAKFTAQGIETRRLNVSHAFHSPLMDEMLDAFEQATNLVNFQ
APQIPFVSNVTGNFLPVGQVPDAQYWRSHTRQSVRFMDGLNTLLAEGYELFIEIGAKPVL
CSLGKRCHGGENSVWLPSLNAKRDNWQTLLESLSTLYLRGVEIDWAGFESDYSSQLVALP
TYAFQRKRYWIQSPNRVDNIPVNHHSNNSQPVTSASSDSAKLPSQALVEKMLKQQLQIMS
QQLEVLRTHNLTKGQFLPLQHGHLPKPPKLNHQPSI
Download sequence
Identical sequences Q3M5M8
240292.Ava_4108 gi|75910307|ref|YP_324603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]