SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4245
Domain Number 1 Region: 3-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.79e-108
Family Cystathionine synthase-like 0.0000000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4245
Sequence length 398
Comment (Anabaena variabilis ATCC 29413)
Sequence
MSVIYLDNNATTQVDAEVLAAMLPYLTEFYGNPSSMHTFGGQVGKAVQQARGQVAFLLGA
EESEIIFTSCGTEGNNAAIKAALAAQPEKRHIITTQVEHAAIINVCKQLEKQGYKVTYLS
VDSQGQIDLLELEAALTGDTALVSTMYANNETGVVFPIEQIGLRAKDAGAIFHVDAVQAV
GKVPLNLKTSSIDMLTLSGHKLHAPKGIGALYIRRGVRFRPLLVGGHQERGRRAGTENVP
GMIALGKAAELAQIHLKDVKREKALRDRLEQGLLSAIPNTEVNGHPTSRLSNTTNIGFKY
IEGEAILLSLNKYGICASSGSACTSGSLESSHVLRAMGLPYTILHGSIRFSLSRYTTEAE
IDKVLQLMPPIVERLRAISPFSNDQADWLQGREEALAH
Download sequence
Identical sequences A0A1W5CKC5 Q44482
gi|75910443|ref|YP_324739.1| 240292.Ava_4245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]