SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4833
Domain Number 1 Region: 11-540
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.46e-166
Family Acetyl-CoA synthetase-like 0.00000000747
Further Details:      
 
Domain Number 2 Region: 519-592
Classification Level Classification E-value
Superfamily ACP-like 3.53e-20
Family Peptidyl carrier domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4833
Sequence length 627
Comment (Anabaena variabilis ATCC 29413)
Sequence
MEKQLRKYPHNQCIHQLFEEQVERTPDAVAVVFGKQHLTYQQLNHRANQLAQYLRTLGIG
AEMLVGICLERSPEMIIGLLAILKAGGAYVPLDAGYPQERLAFMLVDTQIPVLLTQKELV
KKLPNHEARVICLDTDWEIINQHTPENQNISITPDNLAYVMYTSGSTGQPKGVSVVHRGV
VRLVKQTNYANFTNTEIFLQFAPISFDASTFEIWGCLLNGGKLVLYPSNTPSIDELGQVI
QKYQITTIWLTAGLFHLMVDENIHALKPLRQLLAGGDVLSVSHVQKFLKTVENCQLINGY
GPTENTTFTCCYHIKDPVRPDSSIPIGRPIAHTQVYILDENLQPVAMGATGELYIGGDGL
ARGYLHRPELTKERFIELNNSNFQSLTLYKTGDLARYLPDGNIEFLGRIDNQVKIRGFRI
ELGEIEREISQYPDVRENVVLAHQTATGEKRLVAYIVLHQSSSYKQEQLRNFLQQRLPDY
MLPSAFMVLESLPLTANGKVDRHKLPTPSKERPQLEQVYIAPQTDLQRQLTNIWSDVLNI
EPVGIDDNFFDLGATSTLIMQIAVRVQQQLGIELSVVKLFQYPTIAGLEKYLNVEQNTQQ
SYNQLQSRAQRQQAAASARRRHSQRGV
Download sequence
Identical sequences Q3M3K6
gi|75911029|ref|YP_325325.1| 240292.Ava_4833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]