SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4837 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4837
Domain Number 1 Region: 462-1015
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.28e-166
Family Acetyl-CoA synthetase-like 0.00000000262
Further Details:      
 
Domain Number 2 Region: 216-478
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.78e-52
Family NRPS condensation domain (amide synthase) 0.021
Further Details:      
 
Domain Number 3 Region: 32-206
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.41e-41
Family NRPS condensation domain (amide synthase) 0.0075
Further Details:      
 
Domain Number 4 Region: 994-1067
Classification Level Classification E-value
Superfamily ACP-like 2.09e-19
Family Peptidyl carrier domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4837
Sequence length 1093
Comment (Anabaena variabilis ATCC 29413)
Sequence
MKILPIENQTELTAIDFDPFADGELLLTAPATESQKEIWASVQMGSAANCAYNESQSLNL
KGQFNLEAFQSAIQQLVQRHEALRTTFSTNGSTLCIVASLLIDIPFIDVSNLEVQEREIK
VAEILQQEVGQPFDLEHGPLFRAKIIKLHPQEHLVTLTAHHIICDGWSWGVLMPDLGQIY
SDLLQGIMPDLEEPDKFSEYAILQEEEEQTSEAIATEQYWLEQFSDSVPVVDFPTDRPRP
PLRTFNAAREDWQLKPELVTHLKQLGTKFGCSFMTTILAGFEVWLHRLTGQNDLVVGIPA
AGQAASGQYNLVGHCVNLLPLRTQIDSQKSFSDYLQTRRSTILDAYDHQQFTFGGLVKKL
SLPRDSSRIPLVPITFNIDQGLDSDKLPFAGLEVEFFSNPRSFENFELFINATELRGQLT
LECQYNTNLFDADTIRRRLAELETLLLGIVSNPDQIIAKLPILPAVEQQLLAAWNQTQTD
YPQDKSIHQLFAEQVERTPDAVALIFQEQQLTYRELNIRANKLAQYLQTLGVGADVLVGI
CVERSLEMVVGLLGILKAGGAYVPLDPGYPPERLAFMLADTQIQLLLTQKHLVEKLPTHT
ATLICLDTDGDTINQTTVENPVSNVTANNLAYVMYTSGSTGQPKGVSVIHQGVVRLVKET
NYVSLTNKEVFLQISPISFDASTFEIWGCLLNGGKLVIFPPNTPSLDELEQIIQQHQVTT
LWLTAGLFHLIVDEKIDALKPLRQLLAGGDVLSVSHVQKFLSTVENCKLINGYGPTENTT
FTCCYDITAPLKPGASIPIGRPIANSQVYILDSHLQPVPIGVTGELYIGGDGLAREYFHR
PDLTAERFILHPFNSDPQSRLYKSGDLARYLPDGEIEYLGRIDNQVKVSGFRIELGEIEI
AFLQHPAVKEAVVVVREDIPGEKLLVGYFVAETGQDNLSIISELRQFLKQQLPEYMVPKV
FMALEALPLNANGKVDRRVLPKPDSSRPELEANYVAPRTPIEQQIADIWTQVLNIKRVGI
YDNFFELGGYSLVGIQVISRLRQALQVEILMSNLFELPTVADLAERVETLRWATQNVQAT
GVETADDYEEGEL
Download sequence
Identical sequences A0A1W5CAQ4 Q3M3K2
gi|75911033|ref|YP_325329.1| 240292.Ava_4837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]