SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_B0304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_B0304
Domain Number 1 Region: 11-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-87
Family Cystathionine synthase-like 0.000000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_B0304
Sequence length 395
Comment (Anabaena variabilis ATCC 29413)
Sequence
MKKITSTNKLDCIYFDYHSTTPVDQRVAEMLLHYMTTEFGNASSIDHIYGDMAKEAVAQA
SVNVANLVGASSKEVIFTSGATESINLVIQSNVSNNNSTKIRPRIAVLPVEHKAVLDTCN
MIAKKNLADIINLQIDSKGRLNLDFLNKICDSGISLICIMAANNEIGNIYPIQEIGQIAR
KYNIPFLCDASQAVGKIPINFEEWGITYLALSAHKLYGPKGSGALVVRKGHQLNPILFGG
GHQKGLRSGTLNVPGIVGLGEACRLRILEMDEDEKAIANLRDKLQNLLLDKVPGLVINGD
VNNRLSGNLHISIPDVSNSAIIARVRQKLAISTGAACSSGVQAPSHVLQAMDLPTDIIDG
ALRIGIGKFTKLEEIEQAAEILSLAVQQTRQVMYC
Download sequence
Identical sequences A0A1W5CD24 Q3M1X2
gi|75812584|ref|YP_320203.1| gi|75812584|ref|YP_320203.1|NC_007410 240292.Ava_B0304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]