SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB1240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB1240
Domain Number 1 Region: 370-481
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000942
Family Dual specificity phosphatase-like 0.034
Further Details:      
 
Weak hits

Sequence:  243090.RB1240
Domain Number - Region: 235-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.1
Family Laminin G-like module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243090.RB1240
Sequence length 504
Comment (Pirellula sp)
Sequence
MRKGSIGGITGYHWRCVPPTPISPPFDEPYRMNLSRQLPLDRSRQTYRRARALPLKSPAI
DGQLIAAGREPSGSPSPKPRRTTLALLATILLTASQLSPTFAADPAAGTPRDTPAGAESL
LEGNLADSWEGSLDDWTLENGVLIGTTDGSVKVNRFITSKIAPVEDFELEVDVWVSARGN
SGIQYRSEVREDLGPNVMVGYQCDVVAATPKYNGMLYEERGRRILCHTAEKVVTDADGQG
WVVESSEPPKFAPEAWHRYKVRVVGNHHQHWIDGQKTAEHFDLDPNGRSLSGRIGVQVHV
GPPMEIRYRNFFVKRLTPTTPPSDSMEIPADAKKIVPQGGWKNAGKRDANHKLVKAELPG
TRKVHRAGPIWLAGQPTAEGLAAAKKAGVKRVITLRSERELDFDDEALVKNAGLEFHAIR
FGGHQQLTDEKIHAVCQLLQAADPDNQALLHCASANRVGAIWIAYRVLDGRQTLENAIQE
GKQVGLLDPDLEKAAVEYVKQRKR
Download sequence
Identical sequences Q7UXM1
243090.RB1240 gi|32471313|ref|NP_864306.1| NP_864306.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]