SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243090.RB9600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243090.RB9600
Domain Number 1 Region: 140-237
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000484
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243090.RB9600
Sequence length 569
Comment (Pirellula sp)
Sequence
MRHSLNSINCKCGDKSILRSRDAGCSVVFAGLSHRLAWMLVLCCFTSQLAHAQIKLDRVF
PPAVAVGAETAVTAEGTFPNWPPNIDCDVNQVSVSAGEESGKLTIKVADDASVGVAWIRF
HDDQSMTGLVPLVLSTADVFSETEPNDKRSQANPIELPTLVAGRLAKGGDSDAYRVSLKA
GQTLVVSATANQVLKSPMDAVLQLTDLRGNVLYHSDDVRGLDPQIVYPTVSDQDLLIRIF
AFPETPNSTIGYAGSPSFLYTLDVTTGPFVDHVAANEKRAIAFGYNLEDQTATVSDIAEN
LSPPIATIPGALGWSWVPPVYEAVHRVLPGDEFEGTLPALLFGHFTKADETHRYSFTANK
GKKYRAEVRSKADGFLLDSKLTITDPKSGKTLASNDDVSSGGYDAGVDFTAAEDGPIDVA
ISEMLGEFGPRHFYQLSIRESKPECQLSIAEDHFVITQAKPLELSVSVNRKSGFQSKIRV
AATDLPEGIQAEPVVSEPKGDTAKTIKLKVTASDNAIGHGRFRILGTILDADDQPTKETI
QATYNLRPSVPLTEFWLTVPPVPAKEASP
Download sequence
Identical sequences Q7ULB9
gi|32475979|ref|NP_868973.1| NP_868973.1.48053 243090.RB9600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]