SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243230.DR_1901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_1901
Domain Number 1 Region: 57-130
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000837
Family Transglutaminase, two C-terminal domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_1901
Sequence length 162
Comment (Deinococcus radiodurans)
Sequence
MFNTRKSALVIAALLSLGAPALAGTSSTQTDYDNATLSLSADGTYAQAVSFSVPSTTVTL
SAEQIRPGNSFTLSIPVTNTTDRDINVSAVAQAPSGTGAAHLKVSGVSTTATIKPGEDAT
LTFTLTFDNSTDAAQAGQTVQVVFDVSATANMNNTSSSGSSF
Download sequence
Identical sequences Q9RT64
gi|15806901|ref|NP_295624.1| NP_295624.1.55610 WP_010888536.1.45201 WP_010888536.1.61927 WP_010888536.1.86829 243230.DR_1901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]