SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243230.DR_2322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_2322
Domain Number 1 Region: 10-179
Classification Level Classification E-value
Superfamily Subtilisin-like 3.8e-38
Family Subtilases 0.0001
Further Details:      
 
Domain Number 2 Region: 218-285
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000432
Family Collagen-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_2322
Sequence length 288
Comment (Deinococcus radiodurans)
Sequence
MTEVTSVRPSSINWAVGNKGSAAAVANMSLGGGASQAVDDAVNNAASKNLVMAVAAGNEN
QNACNVSPARAVNAITVGATTKTDSRDTGYSNYGSCLDIFAPGTNITSTWIGSTSATNTI
SGTSMATPHVTGAVALLIAEGNTTTSAVTSALLNNATTGKLSSIGTGSPNRLLYTGSGAT
TPAPTPTPAPGTTTTYSGSVSRGGSSYKPGSSGFSYAGGTLSAQLSGPGGTDFDLYLQKY
NGSTWADVAASEASGSSETISYNAGAGTYRWEVYAYSGSGSYSLTETK
Download sequence
Identical sequences Q9RS05
NP_296043.1.55610 gi|15807313|ref|NP_296043.1| 243230.DR_2322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]