SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243230.DR_B0069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243230.DR_B0069
Domain Number 1 Region: 161-198,233-471
Classification Level Classification E-value
Superfamily Subtilisin-like 2.36e-71
Family Subtilases 0.0000125
Further Details:      
 
Domain Number 2 Region: 594-710
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000085
Family Collagen-binding domain 0.017
Further Details:      
 
Weak hits

Sequence:  243230.DR_B0069
Domain Number - Region: 514-570
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00216
Family Rhamnogalacturonase B, RhgB, middle domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243230.DR_B0069
Sequence length 744
Comment (Deinococcus radiodurans)
Sequence
MKRLSLAALSLTVLLAACQQQSTVVNPRPPVTSSPMQAGGIPTPDIDPARIILDPNSGAQ
YVSDQLVVGLGGLDSTTLAAQLGATVIDRLPQLDAVVLHLSDGSALQKARQLNEEGRVTF
AAPQQIMQMEPYTKSIREPALSPLAVNQVFDALPQYALDSEHLNAKAAWDAGFTGRGVTV
GVIDDPVDVSHPDLRANWAGKAYDPKADKTYTTVQSWLDAIDAFGSVPMPVDNQVDENIE
HGTAVTSTIAAARDGRGVVGVAPDAKYLTAAMFQPGSVGSAGVAKAILWMVDNGAKVLNN
SWGGAGFDPLIKAAMDYALERNVTVVVSAGNESREYYQRPALFAGVIPSAALAVNNTKAS
FSSFGRHISVAAPGTDILMASPLFINDDGTRKLGATPPDGSGYVLMSGTSFSGPYTAATA
ALILGAHPELDPYQVRRLMEETADGSVGENPNGFDRGTGYGRIQLGELAQRLQSGPMPAK
GGALKVLVQFKKSDGTFVTQTQPSDVIIEKDGENGAIYGAQTNAKGLVQFAAMAPGTYTL
RVGGPDLKADTALKERGSYTGKVTITSGTTLADAEPIVVTLDKGFYEPPPPVVDPYEPND
SLETATQISIGMRTQPALIYRESCSSSCTPVNGDVDFYKFSGTAGQTVEVALFDKYHPTE
KIGNMWGVIYIRDSTGNLLKDSAGKVIQPGIVDNKFTAKLPTDGTYYLQAGTYLHLNPTQ
GEKPYTGGFTNSKDNKYFIELKLK
Download sequence
Identical sequences Q9RZQ1
243230.DR_B0069 gi|10957460|ref|NP_051605.1| NP_051605.1.55610 WP_010884010.1.45201 WP_010884010.1.61927 WP_010884010.1.86829 gi|10957460|ref|NP_051605.1|NC_000958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]