SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ0082
Domain Number 1 Region: 6-250
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 3.92e-124
Family Methyl-coenzyme M reductase gamma chain 0.0000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0082
Sequence length 266
Comment (Methanococcus jannaschii)
Sequence
MAYKPQFYPGNTLIAENRRKHMNPEVELKKLRDIPDDEIVKILGHRNPGESYKTVHPPLE
EMDFEEDPIKDIVEPIQGAKEGVRVRYIQFADSMYNAPAQPYDRARTYMWRFRGIDTGTL
SGRQVIEMRELDLEKISKNFLIDTEFFDPATCGIRGATVHGHSLRLDENGLMFDGLQRYI
YDEKTGHVLYVKDQVGRPLDEPVDVGEPLPHDYLAKITTIYRKDNIGMREDKEALEVVQI
IHEARTKGGFGLEVFKKDLKKRLGEE
Download sequence
Identical sequences Q60387
243232.MJ0082 gi|15668253|ref|NP_247046.1| WP_010869574.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]