SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ0425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ0425
Domain Number 1 Region: 33-117
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000279
Family Hjc-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ0425
Sequence length 140
Comment (Methanococcus jannaschii)
Sequence
MVQVVYPNMADLEIGNVKEVYNKILASLNEYYGKMFENLVFEMLKLKIIDFGQKSVAKWW
HKGEEIDVLAYNNNKMIAFEVKWKDLSFKEAKGILRDLERKLDKVDFDGEKECYIIAKSI
EGKEKLKALDLMDLEKLIIF
Download sequence
Identical sequences Q57868
gi|15668601|ref|NP_247399.1| 357474 MjR59 243232.MJ0425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]